SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|444445|estExt_fgenesh2_pg.C_440038 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|444445|estExt_fgenesh2_pg.C_440038
Domain Number 1 Region: 28-147
Classification Level Classification E-value
Superfamily PH domain-like 1.13e-23
Family Pleckstrin-homology domain (PH domain) 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|444445|estExt_fgenesh2_pg.C_440038
Sequence length 776
Sequence
MAGKEEAGKRETAAKEGLPRESVTTTLSGMQNQRVLWGDPEIAGYLEKRGGRFTSWKRRY
FVLQGYFLFYFISEQQTETPLGLIPIEGCTIKESADVGGKLRRYVFYLNIGTQHVGFSKT
ETYILAASSRDNLEEWTEKLVLAAESREELQGDLRCARAVVGEIRGLLALSPSEKRLFAS
LHGEEAQALQLELLRANAEMADLKKEIEAVSIEADRQESAVLQQLILWDIMSLTDPGREP
NDDYPTLTRLQDEVRYSDEIYRLLFKKGSLFQGDGLQDLTKECRILLVSFVRQVLDLIEE
HHAKIRAKAPRFSFNVDSSIYEDMFYVKAPVLDDEQATLELLARASKSDDDSDEEHETEE
EFHRRFTVVQPRASVDSLGRRSSRRQSAIAIPPQTSRKSSGGGSAKQQQQQGGPRPKLFP
EQQRPYQLTRSPSRGWQVTPAGGGSPLSLAPVLRKRTHFYENPNMLGSVVTGRTIADVVE
EGDAATATAAAAAGDQSTSIESMRQRVQKVDPIFTSHFGPETRPPASHIKHDANSTQLVP
TSAPELPPGFNPPYSRPNVLAYVKGTIPRAKSVRPLRPSEAAALAAAAAGTSSAPGKQSV
TPPRSRPNTPDVAASSSSSTAVAATTGAPAATPPKISERRSISIAPQVVEVSEKAPKPAD
AKPRPTVKFGPDSNLGEVASAAASPPRASPPRSRPVVKFADEGDSVITITGPGLVGRASF
IGIEPEALEAGPSYGRIRDFPVVVPSILNSDVGLVFPENTDLFNAPQDNEDEEEGS
Download sequence
Identical sequences D8SAM7
jgi|Selmo1|444445|estExt_fgenesh2_pg.C_440038 XP_002980362.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]