SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|447723|estExt_fgenesh2_pg.C_980063 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Selmo1|447723|estExt_fgenesh2_pg.C_980063
Domain Number - Region: 739-864
Classification Level Classification E-value
Superfamily PH domain-like 0.00587
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|447723|estExt_fgenesh2_pg.C_980063
Sequence length 4140
Sequence
MLEDYVAFYLQKYLGKYVKGVSKEALKISAWQGNVELTNMQLKPEALLELKLPIKVKAGF
LGSVKLKVPWSRLGQEPVIVTLDRIFVLAEPSFKVEGVDDDAEHETALVTSTQDQGQQQQ
PEMNNSWLGSLIGTIISNIKLSVTNIHIRFEDTESNPEQPFAIGVTLEKLAAVTVDDNGK
ELFVSGGALDKINKAFEPGVREDAEKVHHAFLLQPVDGMARYSKLGTRDERSADKPAQTA
AVVLENLTRIVKQPQYRDVLTLFDNISTFNMRVEHAHYRPKVTVAEDPAAWWQYAIKATI
EKNRKASGHLSWDQLLHHARMRKQYLSSYAKCLLANPDRISINDDDGIRQLESSLNKDVI
VQWRTIAHTLADQARRENAEHEKEQAKKRWWPFGWGGQSDGGGEPRGLSDDEWQQLNQAI
GYQEGKPSTLMPGQDAPNMLHTVLQVQMHYNASKLISENEEELLTLSCEGLQSSIRLYSE
AKDFDLKLESYKICCPEGLLAESASHLDALSATFSLAPVNEDLDWSLSAGASPCYITYHK
ASIDRVIAFFSSRTSVSREVAIQTAAAFQMTLDEVTRKTQQQFNEALKNRPRFSLFLDIA
APKVTIPTDFYPKNSQRTKLMLDLGHFKMKTERGEEQRISQEESEMYMCFKMQLNDVSGF
LVDGDCDWDAVHSSKDSGVLPVIEKCAVFALLQQICVPHPSYPSTRVAVRVPSVAVHFSP
ARYHRLMQVVELLQGGSTDVSVRPWEPADFEGDLTVLAWKGMGNREAVWNHRYGVIAAPS
FYILESVSSESYEHCVSLFGKQVYLIPPESVGGIAHVLALCDPEQFSKKVVESVSAVILR
FKDEDTLENWRAHFMAIIRKLNSSQAVVRGTAGKDSKDKNVSPVGPAAEKEKLFLTGTLD
ELKICIASTKTGHSDREQVLLGEEGSLLELRAIGSKASGIVHGYVKVEFLMRDNDMAVGA
ALLSLEIEDRWYGQTSPSCRYLARSTISESELNNPQKESIARENSPAERFFDSSDEFDFE
KTSQEDGSGKSVLSRRSSSQFYDADSSFHEKRSEFVRTPDLLPPLEDQLTFGRDQELKSF
IKAQVILSTPEATSYSNIDKQVKVSLATLAFYLNRPTLVALMDFVTAITTSVEPKSDTPQ
SEPGDSKDVVSLITPADVHQSGSVPMFDRKDSVVKGLLGTGKVRVVFLLILDMDRAQLVL
NRDDGHQLATLSQEHLHVTVKIFPASYAIVATLGNLRITDDSLKGGHPYYWLVDMRDPAG
KSFVELEFVSFNEDDDDYEGYEFSLSGQLSEVRVVYLHRFIQEISSYFLGLVPADPGYIV
KLKDKVGDAEKTFTQSEVQGAPAMKLDLSLNKPIVIFPKDTNSNSFLELDVLHIHVINTF
QWLGGGKEDIGGIRLELISLKVENIHLVVSVNGKFGENIIKDSSGLVVTVRRTLRDLRRQ
LPAIDASVEVQLLKAAMSDKEYQLMIDCCTSNLSEAPNLSPPVCQPGKGKEKAEEKEEEK
EEQKEEEKEEQKQEQKEEKEEAPHAETKDVQEGSTSASNSSEVWTTLKLTVDVSIIELAV
FIGRTQYTPLASIQVSGVWAAYKMSSNEEQYIMASLDSLNVSDDREGIEPELKFMVGMAS
DDSSLLNRDEIEGSRLVMLVLDAKLNPASQMITLRIQRPRVLLALDFLLAVAEFFIPSIA
DVLGSNTGGNDELPFDMKNWLFLHKSPYFQDSDEVTLSPKHALVADDENIEIYIYDGGGG
RIRLTDASGDPVGDSFEGPLVVVGHGKSLRFRNVVIENARCLDRFVLLGSNSLYSASKHD
GVFFEWKDEQPPEGDDESANKKNNTSTKAELTFDLQAIGPELVMHTSGGSSSDIKDQLLF
AKMDIFSRLVMKGDDLEVSAKANNFCIQGRRGIYVLEPVDTNCRYSKVSTKQNLHATMSD
VVCNLTFSMIQLILKLQEDAQSLILLTSKKIAVECTEFDRIWADEVRSGSSQIAFWRPRA
PPGFTVLGDCLTVVDEPPSKGVIAMNMNLVHLKKPVDFRLVWSSSANEDDSEQCCVWLPI
APEGYVVLGCVASIGRSPPSASPTLCVLKQLVTEWYMRDCIQVNGTTEQEWAFWRADNSS
ASFFPISALRKPHSSRIYELRHVAFELEKAEDRFGTTKTSGESARSSDEDNGVLLTTVTR
FKLIWWDKGAKSKKSVSIWRPVTPSRCVILGDIAVEGYEPPSVAFTLQDTQDNVLLQKPL
KFVKMGVIHEKKGLKPVTFWFPVAPPGYAALGCLAIRGYTLDAEASDKIRCVRNDFVLET
EFSSPSLWDGRQVKRLNDDISIWPLQTMDHESKAATFVTNITQEAPPKQLAFKLKDIGNQ
SNTDNLVGDGEIRRVSATIFDDFGGMVAPLVNVSLNGLTGSVHGTPDAMESTAHFSMVAT
SYNGRCDAWEPLVEQTEGYVRYTKESTSLCSSQSQVSVAATSDLNINVSTANLNMLLDAY
SSWNKLVSMDAAPKGRGGARKQTVQERKLQIVCHNDLGQRFYCRHLDEDSSIKITPIESG
ESETFRTPSVMSLQDPFTNESVRRKSVTVLTLALCDAEVPKDDGFGGRQYMVAVRLLPQL
KTAEQHQFHGKTGPDGDRVSLLWNEVFSFAIENVQAYSMEALVTDLSKGAPAGYCCIASL
RELKLYAGTLETDLFAGAADQVNHHNPVGKIRFAYKFHSMARSLQDSNLRNVERTGLDPG
TIQVGSSPDGPWTKLCLTLASRSSYLKIGSEAAASELGVIGGVKHLTVRSLVRLQNNTSV
TMEVSLFPHSANQDSQENDTISEEVFENERFQPMLGWGSSWPGHLLPLDPGRWSKRDLSG
SSQEFPQVELPLGWEWSSDWFVDTSVLDPDGWVHGFSFQALTDFPGGNYVGKLNFVRRRR
WLRTRERTSSLESSRCILGSIKPGEVIGMPLACFREARQDYSLQLRPQFDGYGWTQAVLC
QTRGQKKLPAQDINVRSLLTDQFLSSCLLEAASAGAAARSMWFCLDVNYTDIGKDAYIGP
VRDCQLMLSAPLKIVNHLPVSAEYSVHDSSRIRGYRMQDKGVVLSGEVAEIYNADVRRPV
YLSFVPEGSWHPTKDLVLISHPFWDVAKDMILENLSTKRQVKIKVHIEYDYEEEVTGKVL
RISVPFWIDCARCPPLRLKVVDIDSRSSTGCLPSTVSSTSEEVLNDIPYSELRSPFTMIS
PFTPKSSGMAASLASDTFGAVSPLADLDKSDGAVEVVATDGKSYFRLLVTTALCPIKFAH
TKVVTIRPFITFTNRFGAELFMKQASQEEPCKLNSYDWRTAFPVSSISETLSLQVRTESS
QWSYPIKIEQEETIHFYVQGDDKKKYFIRVEVRSHQEGSKFVLVFRRGSLRGPYRIENRT
RQKRLRFRQLGTSGDDWELLYPNCTRSFALKHPSGQHILELLPEGVPEDKIHKYDLDKLE
ETNTLDVHIRGLVLHGFKLIKLTDSDEKQQEPSEAVEDEQLLQPKEATDQLKIVLDIGKL
GFSIIDQRPQEIFYLYMENFKFSILNSFQENTTRFKVRFKYLQLDDQNILSASPVIFAPD
SRGLSSDENVLKASVILLNDKEEGTKVYPYVGFWVTKRAWRINVHEPVIWTAIGMYNNIQ
LDSLSSDSQTVEADPEIRTNLIDISKAHLRVTLQTEPGLRPRGVLGIWSPLVSLAGNTSK
MAIHLSGVTLENRYMRQSEVSTAVLNHIRKDLVHQALQLLLGVNMFGVASSTLETLSKSA
ADLSRDEKFQQVRLKQDRLKHVSGVGDGLLRGGEALARGFAFGLSGVVKKPCNSARENGF
VGFFQGIGKAFTGFVFQPLSGVLDFIALTVDGVNISYTRCFEVFTHERNLTRVRLPRAIR
SDGVLLPYDERAALGQAMLQLAEDHNFGQNVVFKDPAKFSLSDFYEDHFDVPENRVVLIT
NRRIILITQPGSYKSIRNVSPSNPCKMRKWQQTRSMPTPRASKRALASDRRKDTDEEASD
SSVSDGRITTKEVILFEQIWKSEQDSSVCCTTFSSAGADCGVQCTIWRPIVPDGYVSIGD
IAYHGTNPPTVTVSYKNNDGMFALPTGFDLVWRNWKDGYEPVTIWKPRAPAGYESLGYVA
SPAYVEPAADVVWCARTDAVEAAAFLEQALWHAKQPWHCYIYQGSEKEWGLASRQENRRY
Download sequence
Identical sequences D8T1T1
jgi|Selmo1|447723|estExt_fgenesh2_pg.C_980063 XP_002989507.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]