SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|448050|estExt_fgenesh2_pg.C_1090018 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|448050|estExt_fgenesh2_pg.C_1090018
Domain Number 1 Region: 129-171
Classification Level Classification E-value
Superfamily BSD domain-like 0.0000000000103
Family BSD domain 0.0024
Further Details:      
 
Domain Number 2 Region: 200-252
Classification Level Classification E-value
Superfamily BSD domain-like 0.00000353
Family BSD domain 0.014
Further Details:      
 
Weak hits

Sequence:  jgi|Selmo1|448050|estExt_fgenesh2_pg.C_1090018
Domain Number - Region: 21-103
Classification Level Classification E-value
Superfamily PH domain-like 0.00059
Family TFIIH domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|448050|estExt_fgenesh2_pg.C_1090018
Sequence length 400
Sequence
MAGASASWRAKSLPNPKSDGVPGILTMTPSGFKWTPNIPNAAKALNVDYRSLRGQRASKE
ATSKKAILNLLTDSTAVQYFFEFENFVDRDASRNFLAPFLANAATPIANNEPAANEASTS
ARPPGQNESLNQTEMERRIKLLQGDSELQRLHQNLVMNQILSEHDFWASRKKTGDNHKMR
TGMASTMLADIRPMADGRTNTVTFNITPEIIHQIFAEKPAVHRAFLNFVPSKMTEIAFWT
KYCRNDYLHRTKNAAAATAEAQDDEELAVFVNDDDIIAKEYRRKIKRVDPTLDIAADNAD
SSLPGHGIYRDRAKDPIDGNMRNKLMRDINRHGEVVLEGRLLEENRNDAMSIAQALAKVQ
QQDTRVEENDRRARAMTELEDLQGPRGLPSVPLSIQACNQ
Download sequence
Identical sequences D8T4H1
XP_002990477.1.77236 jgi|Selmo1|448050|estExt_fgenesh2_pg.C_1090018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]