SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|45585|gw1.77.257.1 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|45585|gw1.77.257.1
Domain Number 1 Region: 13-120
Classification Level Classification E-value
Superfamily PH domain-like 4.56e-19
Family Pleckstrin-homology domain (PH domain) 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|45585|gw1.77.257.1
Sequence length 317
Sequence
SKSSLEKIKKQLSAGSGNSALQGPLFKRSETLRKWNQRWFTLDPATGKMEYRLDRGDLSS
RGQIYFDADSTITLSPINFHGAKKYDGCCFYIGTPNKKEYYLCAESQAVARAWVATLRAS
SLVLKAHKEAVNSLSGNGAAKLGTVAAVVTAANTVAKEAAKDIASEMQTSIKATLSGKSS
QTASGDGGMDNVSIMKETLRVKDEELHQLSRELRTRDVTIKELADRLSETADAAEAAARA
AHAMDKERKAARAEADRALKELDDRTKVARLQLKAGEERYAAVMRERDEALVEAQRWQKE
LAKAREQMLLMEAARIR
Download sequence
Identical sequences D8SU83
XP_002986942.1.77236 jgi|Selmo1|45585|gw1.77.257.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]