SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|55884|gw1.31.395.1 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|55884|gw1.31.395.1
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily TPR-like 0.0000829
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 
Weak hits

Sequence:  jgi|Selmo1|55884|gw1.31.395.1
Domain Number - Region: 101-244
Classification Level Classification E-value
Superfamily TPR-like 0.0813
Family Transcription factor MalT domain III 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|55884|gw1.31.395.1
Sequence length 267
Sequence
WNNLLAAYAKEGHFDEARRAFKRMPQFSMEACIAMSIACVNKGKLQSAQRVFEKCHHKDI
LSWNSILAAFARSGHLLEAKLVFKRIPRRDFGSFKGIIAAYVKKGKPHKGRMIFRRIPQT
SRVLDPEISEMLIRGYGSQGMVMEAKNVFESMPQPSASCWAAMVECSVKNKLLLEFAKVV
FDAMPERNFSTWDSIFGAYLRLKSVEESRILFDSVPERTSSWWSSMISAYTRQGYPAQAL
RLFKLMDLDGFRPDYGTYGTALFVCSS
Download sequence
Identical sequences D8RZX4
XP_002976560.1.77236 jgi|Selmo1|55884|gw1.31.395.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]