SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|6193|gw1.28.55.1 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|6193|gw1.28.55.1
Domain Number 1 Region: 2-127
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.42e-25
Family Protein kinases, catalytic subunit 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|6193|gw1.28.55.1
Sequence length 127
Sequence
VREFELMRECKHENVVKVLDMVQEEDGGYIVLEHLWDIREFNKDERLRYKLSKVGWIKET
MRQLLVGLASLHEREVVHQDILPECLKFELNSNNFVVKLGDFGCARKLSTPPTVHIGSLG
FRAPEVI
Download sequence
Identical sequences D8RWV3
XP_002975690.1.77236 jgi|Selmo1|6193|gw1.28.55.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]