SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|73652|e_gw1.0.1394.1 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|73652|e_gw1.0.1394.1
Domain Number 1 Region: 5-58
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.00000000602
Family Chaperone J-domain 0.0037
Further Details:      
 
Weak hits

Sequence:  jgi|Selmo1|73652|e_gw1.0.1394.1
Domain Number - Region: 90-151
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.000126
Family Single 4Fe-4S cluster ferredoxin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|73652|e_gw1.0.1394.1
Sequence length 210
Sequence
MRSAAPHEILGLSAARGFGLDDVKAAFRSKVKEYHPDVYRGAEDPEAITQCLIRAYEVST
SFVHSLERVFLIEPRSLDPFQEPEGEANDIFVNELLCIGKGCPYSCVERAPSVFRYNPET
GRAQAVVQGRSGDYSVQLAVGQCPRNCIHYVTEEQGKVLRDLLHRASIDPYNSNDFTTIQ
GLIARAAYENGRYRGPKRKPKRSDKMVDYY
Download sequence
Identical sequences D8QQ92
jgi|Selmo1|73652|e_gw1.0.1394.1 XP_002960881.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]