SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|82084|e_gw1.4.610.1 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|82084|e_gw1.4.610.1
Domain Number 1 Region: 170-375,404-441
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.77e-31
Family Phospholipase D 0.088
Further Details:      
 
Domain Number 2 Region: 477-606,653-759
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.62e-29
Family Phospholipase D 0.083
Further Details:      
 
Domain Number 3 Region: 7-154
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000686
Family PLC-like (P variant) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|82084|e_gw1.4.610.1
Sequence length 810
Sequence
MASFLMHGILHATVFEAVGITDQTRVTGAAPEFLRMIVEGVEDVVGLGRGSNRMYATVDL
DKTRVGRTRVVDFSPKSPVWNESFHIYCAHNVAHTIISVKADLRIGATVLGRAKVSVLNL
LSGQPLENWLDLCREDGKPIKSAKVRVRLQFFDVTKDPNFGYGVRDGFRFPGVPFTYFKQ
QRGCRVTLYQDAHMSDNFLPPIFLAGDQLYQPTRCWEDMFHAISNAKHLIYITGWSVFTE
ITMIRDPARASLGAEAQTLGQLLRRKAEEGVRVLLLVWDDRTSLSVVKTEGVMNTHDEET
FNYFKNTKVKCRLCPRNPDSGLSIVQGFQIGAMFTHHQKTLTVDVPAPGSHMRAITSFVG
GLDLAAGRYDNQHHSVFHTLNAEHKDDFRQTSFPRACRKFGGPREPWHDIHARIEGPAAW
DVLHNFEQRWRKQASKDANWLLELAQMRSIVPPTAPACPGEDWNTWNVQLFRSIDAAAVA
GFPQDPAAAGAMGLVSGKDNIIDRSVHDAFIAAIRRAKDFIYIENQYFLGSSFAWESHQN
AGAHHLVPREIALKIVSKIQAGQPFRVYIVIPMWPEGVPDSPQVMAILEMMVRTMEMMYR
TIAPALFAKQLVDVDLRDYLSFYCLGNRERRAPGDYLPVESPEPGSSYKLAQDHRRFMVY
VHSKMMIVDDEYIIVGSANINQRSMDGGRDTEIAMGAYQPYHTCLAQPPRGQVHGFRMSL
WYEHTGVLDNDFLAPSSVQCMRKMNSMGDYYWQLYAGEPEVDLPGHLLAYPITVAKDGTV
SELPGFSSFPDMKGRILGGRSDYFPDILTS
Download sequence
Identical sequences D8QZ93
XP_002964421.1.77236 jgi|Selmo1|82084|e_gw1.4.610.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]