SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|91721|e_gw1.12.595.1 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|91721|e_gw1.12.595.1
Domain Number 1 Region: 190-352
Classification Level Classification E-value
Superfamily Bet v1-like 8.52e-30
Family STAR domain 0.008
Further Details:      
 
Domain Number 2 Region: 7-121
Classification Level Classification E-value
Superfamily PH domain-like 0.00000745
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|91721|e_gw1.12.595.1
Sequence length 725
Sequence
MSSASEKRASVYAGWIYHVGSNSMGYQFCNPRYLVIKGKYVEMYKRDPNDFPSKKPIRRG
VAGKFTMVKEIGRQIIHGRVLYVLKIYSRVDHGKHGEIACTSAEEVEKWMSAFRHAKEEV
CQEGSSESLVHRCVLSRRSMFNVNGPRYHSKSYLSKLIYIGRGPESLLRRPSMVAQDPLP
AVSYTKQAGDAVEQTDWRCFRTVNGLRIFEDVKSENGAIMKSVGVVEATPEMIFEMIMTL
DISLRHQWDTLTGQLELVEHIDGHTDIVYGTFDPKYFKRYYVFSRYWRRHQDGSYYITQM
EVSHKGAPRKPGYRKITLNPGVWEITPLPSKPGTGTPRSLVTQIMEIKSTGWGRWKKSHY
SKFHATVPYAMLCRTAGLSKYMLAAHHQERLVTKSIVNHDESTCETTRLSQVETNEEFYD
AITAGDPADEDDDDSEEEEKKPLNKTGSHKLRRVTWGVMLLSKRPPAPGDNGELMLGCSA
MEINMKLFKSTLRHQSSEKDQNCWCDPGGQGFMVRGKTYMKDYLKVPGGDPLLKLLTVDW
LKSDDKIGAIAKHPASIVQTPAGKALPFIFVVNLQQVPAKPNYSLVFYYAADRPIRPGSL
LDKFANGDDAFRNARFKLIPSIVEGYWVVKRAVGTKACLLGRAVTCHYIREDNYFEIDVD
IGSSSVARGVIGLVLGYVTNIVVDLAVLIEAKEESELPEYLLGTTRINRIVPEDAEAYEG
WRQHP
Download sequence
Identical sequences D8RDQ0
XP_002969451.1.77236 jgi|Selmo1|91721|e_gw1.12.595.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]