SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|107448|e_gw1.35.377.1 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|107448|e_gw1.35.377.1
Domain Number 1 Region: 564-847
Classification Level Classification E-value
Superfamily BEACH domain 3.4e-122
Family BEACH domain 0.0000000165
Further Details:      
 
Domain Number 2 Region: 968-1207
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.22e-35
Family WD40-repeat 0.0037
Further Details:      
 
Domain Number 3 Region: 411-539
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000738
Family PreBEACH PH-like domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|107448|e_gw1.35.377.1
Sequence length 1215
Sequence
LYDQVWDLLSAINGIGQGGASTSTAGPTFGQRARGLVESLNLPAAEVAAVVTGGLGSVGI
NVPSSKPNEKAMKLRGEKFPRLAFRLVLVYLYRAGLEAVLLSVQQFLPLVPGFLSSDSDQ
NKGQLYLTIWCLLDARSQVEKMDDGTRSHVLSQLIEELIEIGKVIGLVDKEKRTEETMKN
DPYSFLQQDKVKALVRDDKKFLRAAKRKWVSAVETLNAETNDTRSLELRESKALEEQSLT
VLNSIHNSELSRRAAYQLKEDAEEQAVASQWCLIFRNLTDERGPWSSTTFPSDTLVWWKL
DKTEDPLRRRLKLKRNYHFDQELLQPAASTEGVGSQSAPKVLSREKVSFRKAASFKLEKE
SEEVEDEMQDANDEFVSNESEAESSSTSEADGAESKQGAAEDEVCHLTLYVLLSVSCVLV
SPKRKLAGRLEVTHRSLHFHMEFFIEGTGGSMVFDSSGGFARQNQDTDQTGTRDGDKAPG
LGKKQHRTWDIFQVTAIYATRYLLQHTALEIFFADAAPPVFLNFASHRVAKDVALTITSS
KHVGSKGKTKHQIHYVDRKRAIDLAEKARDCWRRRECSNFDYLMILNTLSGRSYNDLTQY
PVFPWILSDYSSEALDLSSPSVYRDLAKPVGALDEKRFQVFEERYNNFTDPDIPSFHYGS
HYSSMGIVLFYLLRLEPFSSFHRTLQGGKFDHADRLFHSIQNTYANCLTNTSDVKEIIPE
FFYMPEFLVNTNSYYIGVKQDGQHLNNVILPPWAKGSPEEFIRLNREALESEHTSENLHR
WIDLIFGYKQRGKPAVEAANIFYYLTYEGTVELETMEDVRQRASVEDQIANFGQTPIQLF
KKKHPKRGPPVPLLRPLYYSPASTTLVSTIPSRSLSFGKSDEDHPVLYIGHCDGKIISVT
SQMVVSSRMWLTPSMPPSGSFTFSSSQDSTYGLGSEEWPCHKVRGYFTESFPDSFCFCAL
PAISTVYLLSCGHWDNSFKLMSLTDGQTVQSLCQHKDVVTCASVAADGSIVVTGSRDTTV
MVWETQLSSNRIKRSDSKLAVSDKPRHVLCGHDDAVTCVVVRTELDLVVSGSEDGTCILY
TLRQGRYVRSLVHPSRKSISLLVVSPHGLVGLFSNKDLNFHSFSVNGKHLASAELNGRLS
CMELSSCGEFVVCGGDQGYVTVRKLHSLELVHRYDAAGSPIVSLCVTPEDCFLVGTRDGR
FLIYAVETSPRREKR
Download sequence
Identical sequences D8S2U1
XP_002977651.1.77236 jgi|Selmo1|107448|e_gw1.35.377.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]