SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|107537|e_gw1.35.387.1 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|107537|e_gw1.35.387.1
Domain Number 1 Region: 297-463,506-552
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.81e-40
Family Phospholipase D 0.049
Further Details:      
 
Domain Number 2 Region: 643-864
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 6.63e-29
Family Nuclease 0.05
Further Details:      
 
Domain Number 3 Region: 211-294
Classification Level Classification E-value
Superfamily PH domain-like 0.00000213
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Weak hits

Sequence:  jgi|Selmo1|107537|e_gw1.35.387.1
Domain Number - Region: 58-104
Classification Level Classification E-value
Superfamily EsxAB dimer-like 0.0209
Family ESAT-6 like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|107537|e_gw1.35.387.1
Sequence length 1019
Sequence
MPVRSPERASASDRCSVFEELPQLSIVSVCRQSSGELRYTIELVYKQFKWTVYKKATQAL
LLHAAVKTRAFLEDLKEKHEKIIEWIQKLQSSWDAQAHEDYEQHDATITRTHSMPRDVPS
AAALPVIRPTLGRLPSIADNSISEMQTYLDHFVKNLELLNSEAVCKFFGVSALSFAPEYG
SKLKEGYVRVCHLDDKEQGCFSSCFNCCGERWMKVWAVLKPGFLAFLAHPFDPKPLDIIV
FDVLSNNTEGQISLAKPERSRLQSGFAVTCGNRSVRVRTKGARGAAEWIAAINDAGLRPP
EGWCHPHRFGSFAPPRGLTSDGSKAQYFIDGKSAFDAIASTISSAKSEIFIADWWFCPEL
YLRRPFALHESSRLDSLLGAKAREGVQIYVLLYKEVALALKINSLYTKRKLLGIHENIKV
LRYPDHFSSGVYLWSHHEKIVIVDQRICFLGGLDLCFGRYDDPHHLLRDDQAVIWPGKDY
YNPRESEPNSWEDATKDEINRQKTPRMPWHDIQCAIWGPACRDVARHFVQRWNYAKRNKA
PNEQAIPLLLPHHHMVIPHYLTGKEAEEALMEAQEELRKASLKPRSSTDDIPTLLPAVEA
PDQTEELKDLLADNSKHSNDGPDGVKWYDANGSAEDWWEKDNPSPQEDVKEVGSRVKCNC
QVVRSVGQWSAGTSQVEERSIEAAYCSLIDKAEHFIYIENQFFISGLDGDSVIQNRVLES
LYTRILRAYKEKQCFRVIILLPLLPGFQGGVDDTGAASVRAIIHWQYRTICRGNSSLLKR
LRDTMGDAVEDFVSFYGLRQHGKLKENGPLVTNQIYVHSKILIVDDRVTLIGSANINDRS
LLGSRDSEIAVVIEDKEFVTSLMNNTAYKAGRFAHGLRKSLWVEHLGFQASEVNVIKDPI
CETTYKDVWTSRAELNTGLYDTIFGCIPNDSIHTRTQLRQIISSRKEKEKNGHHVSIDLG
VADDSSHAGGEAPFFSSNATMVEGIRGHLVCFPLNFMCDEDLRPVFNESEYYASPQVYH
Download sequence
Identical sequences D8S3H9
jgi|Selmo1|107537|e_gw1.35.387.1 XP_002977933.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]