SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|110788|e_gw1.41.178.1 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|110788|e_gw1.41.178.1
Domain Number 1 Region: 1945-2228
Classification Level Classification E-value
Superfamily BEACH domain 7.06e-122
Family BEACH domain 0.0000000164
Further Details:      
 
Domain Number 2 Region: 2264-2559
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.36e-33
Family WD40-repeat 0.0039
Further Details:      
 
Domain Number 3 Region: 1781-1822,1857-1921
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000141
Family PreBEACH PH-like domain 0.0066
Further Details:      
 
Domain Number 4 Region: 357-595,837-929,1058-1119
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000285
Family Armadillo repeat 0.055
Further Details:      
 
Domain Number 5 Region: 596-749
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000182
Family Pentraxin (pentaxin) 0.041
Further Details:      
 
Weak hits

Sequence:  jgi|Selmo1|110788|e_gw1.41.178.1
Domain Number - Region: 124-447
Classification Level Classification E-value
Superfamily ARM repeat 0.000309
Family PBS lyase HEAT-like repeat 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|110788|e_gw1.41.178.1
Sequence length 2568
Sequence
FRNVNSLQSVCDIGGLHKFIRLFRWAAFSFPVLYARSTEHLAEMSTRSSTTTQEKEKDRF
FLGIEDVKDNYGPWNSNVSRLCEVLCSFVIATWDIFSLSGPASQETSGVTSVYWENATRL
VVNVLLGIFRNLDDNDEGDLQRNIITVFKKMLAVSSAVLQLFRDEGVWTVMFSNDFFYFG
LEGKESLETQPLQLEVISFVELAATTSGNSNNLAECNALVQSLEQCSKLPSMATMLLKSL
HRILQLTPELTSSSFKELQVILVLSEVMAALLQDLRLDVGDMENLLHCRDAAFSLFNECL
SLSDDAKSSALRSTKLMDVLFGMILDSRSRTFAIHHVSNFMKVSPISDEDQDAKMELCMK
YLETLSRVQSDQHSAGIDIVLDLLSILRDVLQCDFPYYQALFREVECFVHIVSLLNEAYP
EEHGKRLCLEVIATLIHLLKGNEASKLAFRSLVGPGYKMLETLLVNRYGYPTQDLLNALW
NMLNEDVIVLLLNFIHLCDPETQLKALDTFLQLLEESTANQSSCVRAGLLCSLMDWFSSE
NESVVLHKLCHFIKLAGGHSMAGKEMRRMFSLLRSTSSSKNNLILSTFKSMLSEQGPSVF
FELSGKNSGIGIKTPFRWPINKGFSFMCWIRLESVSSEGMMSLFSFLTGDGKGCAAFISA
DKFFIEVLSLFSVAILVFLTLALSCHSTNYYTFRYPKVYDPVSCTIGANATADQSSGFFS
PLCGQLGPVYLFDDVLTPGQVEGVFMLGAGYMYSFLPSEAGCIPANMSDSSLSSSKEGLS
SKMIFGYNALASSGRVLFDVAPVSEQSDAVSHEATIMSGTQLCYRCLVQNNIHCVGGITV
FFPLLTRFRHAGKDFDGSVTDADDYYLADVIELLTAVATKNYVNQKFLHSSGGLGLLGYL
LQFVSIKQLSVKVITALNNLLRVLSEAADNALSDLLVRETVLKVYLNPSAWIYAPYVIQR
ELFLSLINFLETRKYGNVCGVSRFLDMLHQFYWDKPKHRKMSKTVGTRDRPRQEELSQLR
ILILSLAETAIRDHMSVSDAKSLISFIDRNDDLICVEEVLQMLLGLLGDPIFLSSFLECV
HSLGGIHIFLNLLSRQQEVIRLLALHVLGSLFLAIPVERKSIWLFGIGGNKGQGDTVISR
QKDLVWSIIKERLLQFPFTDSLRVTLFDLLLGAAIPKQVRENDFETSISAGNPAHTATFP
EFFLPQVLGEPGWQDWLFAVFSSASSRKQKEDQDSKRWADEVLLIRKIFCALQVHAVFNT
KGGWRQVERMTVYVLKYTEQVCCSDKIALRAYFFLPFQSFLHDLLGDIVSEISDSRSLLT
LQPCRDNVLYLLALIEELVVADAIQYLPVKALFPSTFHVLMLLMFLIVQFLNSPAEESED
NGLLSGSYVDLGSETGEEGLRLYDQVWDLLSAINGIGQGGASTSTAGPTFGQRARGLVES
LNLPAAEVAAVVTGGLGSVGINVPSSKPNEKAMKLRGEKFSRLAFRLVLVYLYRAGLEAV
LLCLLDARSQVENMDDGTRSHVLSQLIEELIEIGKVIGLVDKEKRTEETMKNDPYSFLQQ
DKVKALVRDDKKFLRAAKRQWVSAVETLNTETNDTRSLELRESKALEEQSLTVLNSIHNS
ELSRRAAYQLKEDAEEQAVASQWCLIFRNLTDERGPWSSTTFPSDTLVWWKLDKTEDPLR
RRLKLKRNYHFDQKLVQPAASTEGVGSQSAPRVLSREKVSFRKAASFKLEKESEEVEDEM
QDANDEFVSNESEAESSSTSEADGAESKQGAAEDEILHFQVLLSVSCVLVSPKRKLAGRL
EVTHRSLHFHMEFFIEGTGGSMVFDSSGGFARQNQDTDQTGTRDGDKAQHRTWDIFQVRH
LTFIVSFLFFKSLQVTAIYATRYLLQHTALEIFFADAAPPVFLNFASHQVAKDVALKITS
SKHVGSKGKAKHQIHFVDRKRAIDLAEKARDCWRRRECSNFDYLMILNTLSGRSYNDLTQ
YPVFPWILSDYSSEALDLSSPSVYRDLAKPVGALDEKRFQVFEERYNNFTDPDIPSFHYG
SHYSSMGIVLFYLLRLEPFSSFHRTLQGGKFDHADRLFHSIQNTYANCLTNTSDVKEIIP
EFFYMPEFLVNTNSYYIGVKQDGQHLNNVILPPWAKGSPEEFIRLNREALESEHTSENLH
RWIDLIFGYKQRGKPAVEAANIFYYLTYEGTVELETMEDARQRASVEDQIANFGQTPIQL
FKKKHPKRGPPVPLLRPLYYSPASTTLVSTIPSRSLSFGKSDEDHPVLYIGHCDGKIISV
TSQMVVSSRMWLTPSMPPSGSFTFSSSQDSTYGLGSEEWPCHKVRGYFTDFKLMSLTDGQ
TVQSLCQHKDVVTCASVAADGSIVATGSRDTTVMVWETQLSSNRTKRSDSKLAVSDKPRH
VLCGHDDAVTCVVVRTELDLVVSGSEDGTCILYTLRQGRYVRSLVHPSRKSISLLVVSPH
GLVGLFSNKDLNFHSFSVNGKHLASAELNGRLSCMELSSCGEFVVCGGDQGYVTVRKLHS
LELVHRYDTAGSPIVSLCVTPEDCFLVGTRDGRFLIYAVETSPRREKR
Download sequence
Identical sequences D8S8E2
jgi|Selmo1|110788|e_gw1.41.178.1 XP_002979623.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]