SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|116002|e_gw1.52.133.1 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|116002|e_gw1.52.133.1
Domain Number 1 Region: 2769-3050
Classification Level Classification E-value
Superfamily BEACH domain 5.62e-122
Family BEACH domain 0.000000016
Further Details:      
 
Domain Number 2 Region: 3104-3305,3336-3378
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.59e-33
Family WD40-repeat 0.0025
Further Details:      
 
Domain Number 3 Region: 2573-2616,2685-2737
Classification Level Classification E-value
Superfamily PH domain-like 4.49e-18
Family PreBEACH PH-like domain 0.052
Further Details:      
 
Domain Number 4 Region: 928-1110
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000056
Family Clostridium neurotoxins, the second last domain 0.075
Further Details:      
 
Domain Number 5 Region: 413-441,479-655,775-838
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000528
Family GUN4-associated domain 0.072
Further Details:      
 
Weak hits

Sequence:  jgi|Selmo1|116002|e_gw1.52.133.1
Domain Number - Region: 109-248,394-441
Classification Level Classification E-value
Superfamily ARM repeat 0.000944
Family HspBP1 domain 0.078
Further Details:      
 
Domain Number - Region: 1236-1292,1397-1536,1567-1608
Classification Level Classification E-value
Superfamily ARM repeat 0.018
Family HspBP1 domain 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|116002|e_gw1.52.133.1
Sequence length 3422
Sequence
ESEQDFKRFWEEFRCGHSDKEKQEALEMALSVFCKLSRRHQNPAQLATSLVDTRQFAFVV
ARAFIADVDKIKSSTSQDTLAKSLIQGKQVPPTVSPIEKTANMLYVLESLVSPPLDVQPL
LDAGLLSCLVHVLYSFLDLTDDFTKAPGNALGISTFLTESVLQVEGEVVHILKALGSHLG
AAQSLADDDSLQMLFAMVIQRPSSVHLAQLHRHVLQILGNVLSSDDGSCAHYIHRHQLVK
MLLRPVKEFTCESGDGTLTVGVVSLLLTCVEVSCRPGAGGINLREDLQNAHGYQLLVQFG
LSLASPATADASASSSLGRLLSLQDSGEETSSGQADLSTSFLALLDTLIDLAQVGPVEES
EPGDLNYNKAKAVAIQSRCFPIFDGTRFKSNESLTDGKVRDLFAVQVLQDIFLKSGNLNS
QVEVLDRLLRLLASHMDNYLVVQELRTLSLFILNMPALPRVLQGQLLKVLEHVVTVVNQV
PEQELLSLCCLLQQSLSQSLRSSILSFLVKILSFDPQYKKVLREVGVLDLLVEDLKTAAK
ISQKKDGQAVHIFEDKVSLAQGWDCLLSLLKRNEANQTAFRKAHGFDALQPLLLSDIHRT
YVLRILSCLISEDTVQSHPEELKALLGTTRAGEGQGITFKAKTDILWAVFRILCSNPAAK
DVFGEGKGFTLMHTVLESLEDFSGAEPRQRMEIVNALLHVVTVGVAGHSVNRIRLNDCVL
SHAFSAALLKTGLICGDYEDLILDLFFDICLEKVQSPARNVDSFRAGTWDNEFISVDERR
ELFNAGLVQVALQLFDDFSPKAQLKVVTSVEALSEGSLVNKDRLTLAGCLKMVLEILTPS
ASYSPAIWMHGMQIVKLLGSYRISSFELRALLRYMWQCRDYTYGQVAQRYIEALEGVVRS
EESSAEISPAARFMDFSSRRNGHASVRISLGDRSWPPAAGYSFMCWLRFTGIEGKTKGGR
SRPALRIFMVESVEEKGTVLAELYLNDSGLLTLATGPSSLLAFKGVRLEEGLWYHIVIVH
NKPNALAGLFQSSVASLYVNGNLRHTGKLGYSPSSFGKTIQAVIGIPPQLSDVSSSTWQM
TGCYLFEEVLPSQAVCLVYALGRGYRGLFQDTDLLRFVPYEACGGGNLAVLEGLETASAG
VNVQKGGDAAKYRIDGSGAVWELERLVSFWIQLSNKKLIFSFDGTPGQTQTAGQQSIVNL
VEPLSAAASPLGGLPRIGRLVGDVEILNPCSFGDSMRKVGGMAVVLALVEAAETGEMLHL
ALSLLVRVLYYNPRNTYDMLACRGYHLLVLFLHRRIRLFEVQDLELLFQIAACEASFYAP
PQSSHFATNTASSGQHPLIDMHGANNNNNVNGPPADDQVSSGGSVFDATDIGPEDIANGM
SEFGSAATPEESLNCVVLSNPDMMEHVLMDWTLWSRASVPIQLSLLGFIERLVAVHRYRN
HNLATLRRLNIVQHLLVTLQRGDIEVPVIEKLVVLLGILLEDGFLPSELKYVADFVVMSF
NPPEVVRDSPISREAMGLQVIVRNVLLEMLIDLQMTINAEDVLETWHKTVSSRIITFVLD
EAAHPTTMRWIMTLLGVCISSSPTFSIKFRASGGYQAISHVLSSFYDAPEIYYILFCLMF
GKPVYPRQPEVRLLDFHALMPGEAIEGEILFTEFLDSILLMFKAAFDKMSLQSQIVQQTG
DFSQFPESLAAGFANGFKDIGGDLQSEALLHKTYAARLMGGEAAAPSLVTSLLRFMVDLA
KMHRPFSTACRRLDFLEGSVELYFSCARYDCFEDLQTFIVVSAGISAEANNQSSYKFSDD
FQVINQKVGAKADAEEPAAQEVELLAVSTKSSPIDIMKPFQADESIDNFFVFPSTYAENT
TNGDDTHSQRSSSFSNAFTESSTSAFVTLPLSPTTSDNSRNEAGTPLPSRTPGNNLASWV
KSTFPSDTPAPSRSASSIPSRTTSIVSASTHGPASDSDRSSIQDDKQAFPITKKLLLQLE
SAGSGGGPCSSGATAVLDLVAEVLADALADQLKATPLVEATLEAVPLHIGGDIAVVFQGL
CLYRVMNFLERRLQRDDEEAHKKLDRARWSSNLDAFSSLVVDRVYMGAFSDSAGVLKVLE
FLLSMLQLANKHGRVEEAMTTGRSLLSLARGGFKQLEPFVQSLLRNTNRMLLFCFLPSPT
TNEELTSSNTGLLAKGGLDITLVLQLLISHKKLVLCPGNVDSEFLQCLLVNIVPLLQDPR
QAVRTLAVDACKVLLHYRKEALEDILVLRHASGEALDVFHGGFDKLLASNSIGFYTWFDD
AHDAIGRVLEQRASLAWMQFIGGAARFNSSRLKNFEVRRKREMGRRMKDASKADGRHWEQ
MLERRVALDMVRDSLSAELRLMRQVKYGWVIHAENEWQDHIQQLMHERGLWPVVKSVAES
DNEWQLCSTEGPYRMRKKLVRCKPKIDIAAHAPEEAEAEVLPNGQAGFAVDIENPDYDSF
FHIFSLGVDSPKKNAAKDYLESFDEEDTESKGREDDANSLSTRGDGTIERSRSAINDSGK
SPESIQRSKSDAHGTAPGSSPTKTGDFQLDDADDQDFQDDGEYLIAPYLERGEKIRFRYN
CERVAGLDKHDGIFLIGERCLYIIENYFIDSAGRICEKGGEGELSVIDQALGVKTSISVV
FESTQTATWSDTENTWPGGKAWACSGGAWGKEKLSSGRQMPHSWRMWKLDSVHELLKRWY
QLRPVAIELFSMDGCNDLLVFHKEERDEVFKNLLSINLPRSSRLETAISGVSKLDSNEGG
RLFKTMAKSFSKRWQNGEISNFQYLMHLNTLAGRGYNDLTQYPVFPWVLADYESEELNLS
NPTVYRRLDKPMGALSLEREDVFRKRYDNWDDPEIPKFHYGSHYSSAGTVLFYLIRLPPF
SQENLKLQGGQFDHADRLFTNIRDTWLSASQGNTADVKELVPEFFYLPEFLENKFDLDLG
TKQSGEKVDDVVLPPWAKGSAREFIRKHREALESQYVSENLHHWIDLIFGYRQRGQAAVD
ATNVFYYLTYEGAVDIDSVRDPALKASTLAQINHFGQTPRQLFLKPHPGRKCQQKVPFGH
VLRSSQLLAPQEIRNATTSIAQIVVSHDKVFSVGHNRLLKPRSYSKYIAWGFPDNSLRFV
SYDQDRLLSTHEGLHDGTIVCAGFSRDGRTLVTGGEDGVASVWRLRKDGVRNQRRLHLQR
ALCAHSDSVTCLSVCQPYNLVVTGSSDCTVIFWDLSTLEFVRQLPQLPAPASAVHTNEMT
GEIVTAAGTMLVVWSVNGDCLAALNVSRLASEAIVSITSPVLSDWMETGWYVTGHQNGAI
KLWRIDYAIFAQGPSRRSRGVPPPRNVCFTGGTPEYHLVLHKVLKSHTQPVTALHLSPDL
KQLYSGDAGGHVTSWVLSTLDGSSVQVKLSHLYADSFQVSQAPALFLVCSPRHARGARMF
WT
Download sequence
Identical sequences D8SFW0
jgi|Selmo1|116002|e_gw1.52.133.1 XP_002982237.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]