SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|126695|e_gw1.84.259.1 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|126695|e_gw1.84.259.1
Domain Number 1 Region: 48-133,161-188
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.28e-20
Family alpha-D-mannose-specific plant lectins 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|126695|e_gw1.84.259.1
Sequence length 283
Sequence
MLLLSRAEAQSLTPGSILTPGSNRFWTSSNGMFGLGFFNSSAPTTEIHVGIAFVDQMPPT
LVWMPNRTQSLSSNSSLQVTDSGLVIIESGETVWRSGAAGAVVAEAELLDVGNFVLRSAS
SNIVWQSFDFPTDTLLLGQKLLPIAGQALSSWRTKADPKPGPFSMVMDGDMSKPRLLYQG
AIEYWSWTTAKFNEFRFSDDPGNETTGNLTVGSIIQDSYCDAQLVSTEFANYRKRLTLDP
DGNFRYYVRAPNSTKWGVVWRALFDACDVYSTCGINGLCDFNS
Download sequence
Identical sequences D8SWQ0
XP_002987757.1.77236 jgi|Selmo1|126695|e_gw1.84.259.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]