SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|159743|estExt_Genewise1.C_910131 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|159743|estExt_Genewise1.C_910131
Domain Number 1 Region: 203-440
Classification Level Classification E-value
Superfamily PH domain-like 5.16e-65
Family SSRP1-like 0.000011
Further Details:      
 
Domain Number 2 Region: 551-632
Classification Level Classification E-value
Superfamily HMG-box 1.57e-25
Family HMG-box 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|159743|estExt_Genewise1.C_910131
Sequence length 647
Sequence
MGDAHQFNNILLGGRGGANPGQLKISSKGFSWRKSGGGKVVDVAKDDVKSVSWTRVSRSY
QMSIRLKAGSNVKFTGFREQDVSSLNTFITSNIGVTPQDKPLAVSGRNWGEAELEGNTLS
FVVGGKPAFEICVADISNTQVQGKNDVQMEFHVDDTANEKDTLMEMSFHVPSTNTTFVGD
EERVSAQVFCDKILSMADVGPAGGEAVAAFETVNVLTPRGRYLVELHLSFLRLFGASDFK
IQYTSVARLFVLPRSAQSSTYVVITLDPPIRKGQTFYPHIVFQYPSEEITELTPLISDEL
LNTKYKDRLAPQYKGLSYEVFVEILRGLSGAGITKPGTKFRSSQEGYAVRAALKAEEGLL
YPLEKSFFFLPKPPTLIVYEEIDYVEFERHGAAGTSSMSSKNFDLILRLKTDQEHLFRNI
SRNEYHSLFKFISEKGLKILNFQTQGSSAVAEALQGSDDEGVDPHLERIRIARATGDEGD
SDEEDEDFVADKDDEGSPTDDSGEEEEPDASDSGGEQQDERPVKKDKKKVEASQKPAASK
KKKKDEEGDGDKKKKRRKKDPNAPKRALSGFMYFSLAERENLKKSTPGISFKDVAKTLGE
RWKAMSKDEKEPFESQARVDKERYTKQMQGYNKGNAGGSTADDESSD
Download sequence
Identical sequences D8SZS6
XP_002988810.1.77236 jgi|Selmo1|159743|estExt_Genewise1.C_910131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]