SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|171046|estExt_Genewise1Plus.C_130508 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|171046|estExt_Genewise1Plus.C_130508
Domain Number 1 Region: 26-305
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.47e-31
Family G proteins 0.00048
Further Details:      
 
Domain Number 2 Region: 572-696
Classification Level Classification E-value
Superfamily PH domain-like 1.74e-18
Family Pleckstrin-homology domain (PH domain) 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|171046|estExt_Genewise1Plus.C_130508
Sequence length 915
Sequence
MENLRVLAESMQQASALLSDQEGEESLDQYSSFLSVVALGNTGAGKSAVLNSLIGYAVLP
TGENGATRAPVTIDLEADDSGNKRGLTVQMEGKSMQVSATDIRHSLQNKFGRMSTGAVKE
NIHLKLKCSSAPPLKLVDLPGLESRSVSDSLVREYIDSNDALLLVVIPATSVRDITGSQA
LKIAQDIDHEGSRTVGVISKIDQAASDPKSLAAVQAVLSGQGPSITSKFTWIALIGQSVS
IAGAHSKDDSLETAWKAEMESLKSILGGASSSRLGRSSLVEAIAKQIRQRMQQRLPSLLS
SLEGRSQDVEEELVRLGEKMVETEEGTRAVALELCREFEDKFLEHINSGEGGSYKVVTSF
EGTLPNRIKQLPLQELFDLNGLKKVVLEADGYLPYLLSPEKGLRELIRRALDLAKDPAKS
CVDEVHRVLVDIVSSAASATPGLGRFPPLKREMISVASSALDEYRTEAKRMVVDLVDMER
AYIPPQHFTRLVQRRLDRVRREDEVKNKTMKKAQEAEQAILNKSSYNPAAQANGSLKSAK
DGDGKDVPESSGAEKDKTGNCLCCHLLFLISFCEGYLSKRSATSADTWNKRWFVLNEKSN
KLGYMKKPDDKRFQGVINLEECLIEELSEEELAEGRPSKSKEASKQANGPEPNLTIKISN
KVAYKTVLKAQHVVVLKAESMAEKTEWMTKLRQCTDQGKGSSKAVVEVVTPLRTSMSDGA
LDTVITRRADPEEELRIMAQEVRDYVEAVMNSLSANIPKAAIFCQVERSKDSMLSTLYKS
ISALPTPTIKELLQEDAQVKRRRERCERQASVLSRLVRQLSNNEARVTMSNGYIEGTQNE
SFAAGYHGGDDWRVAFEEAANSPSPRTPSGFSSSSRRSLTPHRGEALENGDSSRRTPTRR
PPPPVPGIGVPTYRQ
Download sequence
Identical sequences D8RFP1
jgi|Selmo1|171046|estExt_Genewise1Plus.C_130508 XP_002969777.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]