SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|175129|estExt_Genewise1Plus.C_280557 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|175129|estExt_Genewise1Plus.C_280557
Domain Number 1 Region: 4-142
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.07e-29
Family Cap-Gly domain 0.00066
Further Details:      
 
Domain Number 2 Region: 140-375
Classification Level Classification E-value
Superfamily L domain-like 4.53e-29
Family U2A'-like 0.042
Further Details:      
 
Domain Number 3 Region: 435-521
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000134
Family Ubiquitin-related 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|175129|estExt_Genewise1Plus.C_280557
Sequence length 524
Sequence
MAEEEEGAGFHLGQRVRSAREAQQLGTVRYVGPVEGYHGVWIGVDWDSGQSRHDGSVNGV
RYFTASGEKSGSLVRPSNLSAGWSLLEALVSRYKISMSKDDAEDMYLMSVRQRKVAVELV
GQSKVEEKQKKLNELRAASLVFAGVSSLGPPGEISSSAPNIEELDLTGNLISDWNFVTCL
CEELPRLRAVDLSYNRIDIRPEMPRPPLNLRTVVLNYCSLSWEQVDMLSKSLPFVEELHL
RHNNIRLLQTSGEAVEGFEELRVLNLEGNSLESWDEMMKLSSLRSLKTLNVSGNAITKVS
YPENIKDQWPFLQLSCLLLGKNQLADWESVDALDKFPNLTEVRLSENPIADTSKGGAPRY
VLVARLSKITVLNGSEVKQYLTAQGVYCRYVRHVLNTMTPGEDIRRSHPRQAQLKKQYDI
SEESVPQAGSQSSQNMAASLITITIKCVAASLGEIAPVTRKLPGSMTVGKLKLLCEALFK
LKATKQRLFLEEKESPLPLPLDDDLESLGNIGFGQQGVILMEEC
Download sequence
Identical sequences D8RXE9
jgi|Selmo1|175129|estExt_Genewise1Plus.C_280557 XP_002975615.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]