SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|184811|estExt_Genewise1Plus.C_1000172 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|184811|estExt_Genewise1Plus.C_1000172
Domain Number 1 Region: 120-582
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 1.76e-151
Family Trehalose-6-phosphate synthase, OtsA 0.000000404
Further Details:      
 
Domain Number 2 Region: 636-856,929-959
Classification Level Classification E-value
Superfamily HAD-like 1.98e-26
Family Trehalose-phosphatase 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|184811|estExt_Genewise1Plus.C_1000172
Sequence length 991
Sequence
MPQYPPLNSQDDDPVGKPQPRRKEAAVAAAAPFVPPNLNLPPSLASSRVERLVRERQLRR
SERASASEDAIDEDDAADQPQEQPPADNISLEHQARDDNPPPSQQQQEDLPADQGGGEKQ
RLLVVANRLPVSATRKGDTQWSLEVSAGGLVSALLGVKQFQVIWIGWPGVYVQDDVGRQS
LAQALEEKGFVGVLLDEATVDQYYNGYCNNVLWPLFHYIGLRQEDRLAATRSLQSQFNAY
KRANQLFADAVIKNYQEGDFVWCHDYHLMVLPSYLKEYNSHMKVGWFLHTPFPSSEIYRT
LPLRAELLQGVLAADLVGFHTYDYARHFVSACTRILGLEGTPEGVEDQGKITRVAAFPVG
IDSERFTHAVETEAVKQHIQELSARFAGRKVMLGVDRLDMIKGIPQKLLAFEKFLEENPE
WRDKVILVQIAVPTRTDVLEYQKLASQVHEIVGRINGRYGSLTTVPIHHLDRSMKFPELC
ALYAITDVLLVTSLRDGMNLVSYEFVACQNVKKGALVLSEFAGAAQSLGAGSILINPWNI
IESANAIAEALNMPEEEREERHRHNFMHVTTHSAQVWAETFTRQVLLFSFLFLNSRTYST
SEMNDSILEAELRTLHIPPQLPTEKAIANYSASKNRLMILGFNSTLTAQVEAPRGRAPDQ
IREMKIRLHPNLKEVFNVLCTDPKTTIVILSGSERAVLDEAFGEFDMWLAAENGMFLRHT
QGEWMTTMPEHLNMDWVESVQLVFEYFCERTPRSFVETRETSLVWNYKYADVEFGRVQAR
DMLQHLWTGPISNAAVDVVQGGKSVEVRPVGVSKGSAIDRILGEIVHSKHMLSPIDHVMC
IGHFLSKDEDIYTFFEPELPFLDAAVFSSKLQDKRVSKSSSKHGSSRHAKSHPATMSPDR
KRSEEEQLIEEAGRWEGSSVLDLKGENYFSCAVGASKRSLARYCLNSSDEVVTFLSSLAA
ATETFPKKESFKKSGWHSPTPRSPRVVTVSN
Download sequence
Identical sequences D8T2E5
jgi|Selmo1|184811|estExt_Genewise1Plus.C_1000172 XP_002989716.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]