SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|404398|fgenesh2_pg.C_scaffold_2000386 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|404398|fgenesh2_pg.C_scaffold_2000386
Domain Number 1 Region: 103-188
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000000249
Family alpha-D-mannose-specific plant lectins 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|404398|fgenesh2_pg.C_scaffold_2000386
Sequence length 409
Sequence
MKTVGVLAVLLVSLASVASGRVYTIPENWTATIQGRELPGFGSSGSYILVSAPRDLNGSS
GEQEFLLSDNGTFGLAFLNFNGTGNYYLSLVMGATNATAGAPIWTANRSKAVSNESRLTK
TAGQLKLLNGDLTTAWSPSDDQTIASIGLDETGNMVLYNSSGGAVWESFDHPTDVLLPGQ
RLVTGQRFASNLNSSTMSEGVFTATMEARAIVLAFSPPSQEQQPYFLWSLGLPSTIDSAR
VRCPGYVAVLQYTTGGAVNMAYERSSAATTSSPCNAPLNVSLGSGNSKRQLRLESDGNLI
SYKLHETGNWETEFLLTQFFGHRACDLPLSCGSYGLCNQTGPCECMDNRATNITTVAESG
TCESPNWASRLATCDTSTRAPIEFRLRSRIASKRAGRIVPALLSFTMVP
Download sequence
Identical sequences D8QV73
jgi|Selmo1|404398|fgenesh2_pg.C_scaffold_2000386 XP_002962951.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]