SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|406744|fgenesh2_pg.C_scaffold_5000625 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|406744|fgenesh2_pg.C_scaffold_5000625
Domain Number 1 Region: 98-221
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.88e-21
Family alpha-D-mannose-specific plant lectins 0.006
Further Details:      
 
Weak hits

Sequence:  jgi|Selmo1|406744|fgenesh2_pg.C_scaffold_5000625
Domain Number - Region: 377-413
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000474
Family Protein kinases, catalytic subunit 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|406744|fgenesh2_pg.C_scaffold_5000625
Sequence length 506
Sequence
MAMKFFLVAFFQLMTILFRVHGRNYSLSQGWEVTNNNQLLELQGSQSNASYRLLQVGDSP
LLSQSGRFGLAFFRFHNSAEFYFALVLGSSNNTNSGVCVWAANRDSPVTENATVRVTDQG
ALEVADWDGKVVWSSPGGVSEMELQDTGNFVLYNSTGGISWQSFDHPTDILLERQVMVTK
QRLISSANSSSLASGNIKMEVEPSGLIFFLNRDTRQPYLVWNLYNGNLPADETSINAPCP
TYHTELEYSAGQLRLSYQPSTSNPSQLCSAPLTAVLGNSSDDWQYLKLENDGKLVPYTYN
SGRASWEQGPPFMRNRLQNAELFVRKKPKDRTVLLGVSIAASVVLLSALGLVVLMIWKHR
LDKVERALALALQGSAQKYTYKELEVATGNFASSLGKGGFGTVYEGTLADGRKEQALWWY
FPAWVVARVSKREFLKVVDTSIRDSVDEDEVKSMLQMLEGRKEILEPPLFFRFALSSAGV
LRFSSTNHLGGSVSVAMVAHQPSGPR
Download sequence
Identical sequences D8R1B6
XP_002965407.1.77236 jgi|Selmo1|406744|fgenesh2_pg.C_scaffold_5000625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]