SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|413139|fgenesh2_pg.C_scaffold_19000361 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|413139|fgenesh2_pg.C_scaffold_19000361
Domain Number 1 Region: 198-264
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000000119
Family alpha-D-mannose-specific plant lectins 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|413139|fgenesh2_pg.C_scaffold_19000361
Sequence length 359
Sequence
MRLKALYLVLLQIFCLSRCSCMRFDEASIPGRLNLQQVVIMEIRIRSFIRTNIQPDIFYN
SQSWGETLQIDTDNFCIVRLTLFTMESDGSCSLGPSPMRLRGSSLIQISNYLVDRIGEAA
RMYGYGRIMAVSGLLSIDYRIYSTSLPQATHISQPLEIVLNINPSNSTLNSTRELYGQNE
CYAFRSGMVSGERGALGSDLYSGSRLVSPNGFYELVLKNDCNLVLLAMGWKELWSSSTAG
KGVRCVLTLQRDGNLVLLGGDGRVDPFQSIVPPGLCFSYGDGHESGQAMNKSFLIQLIPQ
QEKSSKLQRLSTVIMRSIECLVPGCSQRVWDPQAMGPGFRIGFITRSKISEIENALMSM
Download sequence
Identical sequences D8RNH0
jgi|Selmo1|413139|fgenesh2_pg.C_scaffold_19000361 XP_002972408.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]