SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|413189|fgenesh2_pg.C_scaffold_20000050 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|413189|fgenesh2_pg.C_scaffold_20000050
Domain Number 1 Region: 64-119
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000072
Family alpha-D-mannose-specific plant lectins 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|413189|fgenesh2_pg.C_scaffold_20000050
Sequence length 306
Sequence
MYSIFGIASPYGRFIFQYRVLRIPISHQPQLSAISISQQDISSPFQYTLLPGNKYDVFAK
LDKNRKLTNTKQQYFFVMLDNCNLVLIIKKTIGWSSNIVDISFDCEVILQPDGNMECASA
PDIRKTGSRQEILALLIFPSEIQDLLSISSRHMPMLARRLFVFQKLLVSIKRQVQWRTMF
GNLSWFKRETGVVYLIIENIDQELECIAPESTRKVIGVTRWRVTSDLQFLMPATQWLKET
KEKEFSFSHVRNKLERQLKGPGRQSISLERLLTIFSCIATGQDFHDNKLDEDAGIQCSKR
LYSQST
Download sequence
Identical sequences D8RNM4
XP_002972668.1.77236 jgi|Selmo1|413189|fgenesh2_pg.C_scaffold_20000050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]