SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|413905|fgenesh2_pg.C_scaffold_22000032 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|413905|fgenesh2_pg.C_scaffold_22000032
Domain Number 1 Region: 118-201
Classification Level Classification E-value
Superfamily PH domain-like 0.00000902
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|413905|fgenesh2_pg.C_scaffold_22000032
Sequence length 432
Sequence
MNTQKELWKRSEVVHALNRSSRRTEDSKLWAFCDFLRHGIRAVACDGILRLAIREKFQKL
WKAKVKHHVNYAHLAATSGSPDMARCQELTRLSGSTSGEATSHDHLKWQGTRHFSAAAAQ
LGSTDEEIQYSGWVEKINNKGAVQPRVMVVSNLAVYNFKSRLTVQCKRRIDICAVVHIVR
SKYSHQFILCCPQEYDYLFSSIQVEEICDIIVAVHKAATGNTISVEYKVEVDLSEFVLTR
QEAKKIRKEHPELALKNSAEDPVQVKTKTNNVAQPSTMTQMKANGMSWSVEDATPSSKLL
PENHPPSAALKDVVVLGHDVGGDSTDDLKVFKVIDELYVMKNKKTGETFALKPVESQSQT
RQPRCTLSAHVNGDDRKGNLVGDQFDITSPATKKEIQAADKNELPPALRRKERTKKKKKV
KAYPVLGMTKRR
Download sequence
Identical sequences D8RR04
jgi|Selmo1|413905|fgenesh2_pg.C_scaffold_22000032 XP_002973500.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]