SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|417150|fgenesh2_pg.C_scaffold_33000160 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|417150|fgenesh2_pg.C_scaffold_33000160
Domain Number 1 Region: 98-222
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.63e-20
Family alpha-D-mannose-specific plant lectins 0.0068
Further Details:      
 
Weak hits

Sequence:  jgi|Selmo1|417150|fgenesh2_pg.C_scaffold_33000160
Domain Number - Region: 426-462
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000531
Family Protein kinases, catalytic subunit 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|417150|fgenesh2_pg.C_scaffold_33000160
Sequence length 555
Sequence
MAMKIFLVAFFQLMTILFRVHGRNYSLSHGWEVTNNNQLLELQGSQSNASYRLLQAGDSP
LLSQSGRFGLAFFRFHNSAEFYFALVLGSSNNTNSGVCVWAANRDNPVTENATVRVTDQG
ALEVADWDGKVVWSSPGGVSEMELRDTGNFVLYNSTGGISWQSFDNPTDILLEGQVMVTK
QRLISSANSSSLASGNIKMEVEPSGLIFFLSRDTRQPYLVWNLYNGNLPADETSINAPCP
TYHTELEYSAGQLRLSYQPSTSNPSQLCSAPLTAVLGNSSDDWQYLKLENDGKLVPYTYN
SGRASWEQGPPFMRNRLGGCLPMACESNSVCSGNAQCSCIVQDQSGHQEQTCPSPSSIPL
VCNHELQNAELFVRKKPKDRTVLLGVSIAASVVLLSALGLVVLMIWKHRLDKVERALALA
LQGSAQKYTYKELEVATGNFASSLGKGGFGTVYEGTLADGRKEQALWWYFPAWVVARVSK
REFLKVVDTRIRDSVDEDEVKSMLQMLEGRKEILEPPLFFRFALSSAGVLRFSSTNHLGG
SVSVAMVAHQPSGPR
Download sequence
Identical sequences D8S1I9
XP_002977254.1.77236 jgi|Selmo1|417150|fgenesh2_pg.C_scaffold_33000160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]