SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|421973|fgenesh2_pg.C_scaffold_54000140 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|421973|fgenesh2_pg.C_scaffold_54000140
Domain Number 1 Region: 183-242
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000393
Family alpha-D-mannose-specific plant lectins 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|421973|fgenesh2_pg.C_scaffold_54000140
Sequence length 458
Sequence
MPDRNAILTNKGNSQHQPWIWAPQNLAANFSPKVNRVLVLAVNLEISRVHGVDPVCLARQ
HGYRFKAGQTRSISREAYNLIQTLPQKKSSYTSGRSFTSWHRVPGSRTCGRTSASIMCHA
RARHSQSSTSSRFAWAQRPALDTANNPVRLLGDPDPDWGNCWPFRSSIIGGADEAVGSII
GRSATLVSPSGRYKARMQRDCNFVLYDTYRDTNKVVWASDTFGKGTGCYLIDANLVLLDT
KGHSNLKQLEEMTVDFVHQSAVSEKLVIAIDVVNKVLEETTLDVPAKPVPVTLEGPPPPA
RAQRHPPEPPIRPMQIEREKCVEEPAIPVTKAEDKFVAPVASVAKQHCESPAKIAKEQLV
SVMKELKSWLLLEFKTARGLTLDHQALGFAKLLDLMTKVWMCSRHHIPGLVSAGYIPLGR
LQVKTKEKEKDKDKARDKRYHASVERLAVVVHQQEGCL
Download sequence
Identical sequences D8SGY5
jgi|Selmo1|421973|fgenesh2_pg.C_scaffold_54000140 XP_002982532.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]