SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|426634|fgenesh2_pg.C_scaffold_84000105 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|426634|fgenesh2_pg.C_scaffold_84000105
Domain Number 1 Region: 77-157,213-238
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.21e-18
Family alpha-D-mannose-specific plant lectins 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|426634|fgenesh2_pg.C_scaffold_84000105
Sequence length 360
Sequence
MDSAHSKQSTTLLFLAAPLVLLGPWASMCHESTPLAMIRLELPKTQRTRTLRCYHENDRS
HTHSVMNVDSGFLTTQRIIWEANREDPVELNATLSGFLTTLASDGDPVLRDRNGRLVWST
GTANRGATRVEVVRETGNLVVFRNNTTLWQSFDRPTDTLMAAAVLNGDGLNLVLNMMLSN
DTAPSGTRSQALCGLNATGGLLPTRSSANTPRNQSFIRLEFDGDLHAYTLENLLIWSDSY
NLLTRNDSCLLPQHCQPFGICSSSACVGCLDLDGTTAGWTDTRSALGALICASTNQCTWL
SRALGNSAPGAKCIEIGLPELLLIVLTQGIGLMLNGLFGTITRSAVSVDCMSHLSPSDDF
Download sequence
Identical sequences D8SX03
XP_002987877.1.77236 jgi|Selmo1|426634|fgenesh2_pg.C_scaffold_84000105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]