SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|427043|fgenesh2_pg.C_scaffold_87000153 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|427043|fgenesh2_pg.C_scaffold_87000153
Domain Number 1 Region: 87-214
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.83e-26
Family alpha-D-mannose-specific plant lectins 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|427043|fgenesh2_pg.C_scaffold_87000153
Sequence length 472
Sequence
MVVLPLMIFLVLLDRTTVFAAISTAPVNTEWTLESGIEPDFMLLNVDTNHALGFTRACST
SPIYYLSISIPLIPDVECTISSDTVVSVWQANRDFPLSANATLAFGEDGNLVLSQGPIQV
WSSGTSGRGVVAMEVLDTGNLVLLGSGGEIIWQSFDHPTDLLLPKQKFVPGSKLVSSVSY
TNRSQGSFFLELQPRGLVGRARAPGTEQTYAVWDLGSHDIAYLMIESCYLVAYNRMESVV
ATKKITAPFCLQFGKFLKLHYDGTVRFWNSYKKSEPVPINGIGECGKYGVLRQSTCACLD
FDPSLQLEPIDRTNPLGGCSLPGEMSLTDDRCNSSGSHELVEAPGYDYQPLEFMQGIPQL
SPNACKESCLLNCSCIAAFFQVGIHDSACYHVTTLYTVAVTPLRQGYASSMFLKIKTSGG
ALPPGRRSAKALRIVANTAIGAFSVIIAVSVLIALIIVRWRKRMARISAVGD
Download sequence
Identical sequences D8SYC0
jgi|Selmo1|427043|fgenesh2_pg.C_scaffold_87000153 XP_002988347.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]