SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|431703|fgenesh2_pg.C_scaffold_165000053 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|431703|fgenesh2_pg.C_scaffold_165000053
Domain Number 1 Region: 144-224
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.7e-16
Family alpha-D-mannose-specific plant lectins 0.0011
Further Details:      
 
Weak hits

Sequence:  jgi|Selmo1|431703|fgenesh2_pg.C_scaffold_165000053
Domain Number - Region: 42-125
Classification Level Classification E-value
Superfamily Cytochrome P450 0.0391
Family Cytochrome P450 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|431703|fgenesh2_pg.C_scaffold_165000053
Sequence length 309
Sequence
MEICYRWKYFATPKSLQPLSIGDNSRQALNSPFDGSHKQSLILISHLDSCYAPPHGTFRA
RLAHGMLSVEQVRRVVERIEGYVENIRDNVPFQAGRTIELVVRFARNTFVHVNLLLFNRV
YDDDGAELLGVDSDIKHCWVYITSLLSGFKNTLGSYLLGGNSLISVDSSYRLTMQKNCNL
VLQSPKGIITWSSGTQGKDSGCCLTLLVDGKLVIVGSRGEMLWLISCDHSFLLLYQKQKA
ANYQAILLTGPGKVLLRHLELETLTAQIGQALGLTAIRAKLRGVDLDAIIVGKPLVKTSL
SFISWFHEP
Download sequence
Identical sequences D8TDH9
jgi|Selmo1|431703|fgenesh2_pg.C_scaffold_165000053 XP_002993621.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]