SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|432040|fgenesh2_pg.C_scaffold_183000010 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|432040|fgenesh2_pg.C_scaffold_183000010
Domain Number 1 Region: 133-223
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000144
Family alpha-D-mannose-specific plant lectins 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|432040|fgenesh2_pg.C_scaffold_183000010
Sequence length 277
Sequence
MRWEFSDQHNAITPADVNMILDAVIDNLIMFGDDTYYESGRAYVDQITVTNNVVIDIVIL
AYHTGPNLDFCHVNPASSMLAVSEMFGVQYRIAPNQQMETLHSQTKILLGSNRGDCQAKL
TTLDNIFYNGLRRNFELQSPNLIYTFKLQDDCSLSLNEAGRRQVWTNGVCGRGVDCYLTV
ELNGNMVVKETPSQAVIWSLDKFCDGPCYAFVTMQRDRNVVLYHVGISRNLSMVPILKHE
TDGCINAVWIISAVLLASLLVLHSLAQPTHCLAQGPS
Download sequence
Identical sequences D8TES7
XP_002994101.1.77236 jgi|Selmo1|432040|fgenesh2_pg.C_scaffold_183000010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]