SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|432506|fgenesh2_pg.C_scaffold_387000001 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|432506|fgenesh2_pg.C_scaffold_387000001
Domain Number 1 Region: 73-168
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000000144
Family alpha-D-mannose-specific plant lectins 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|432506|fgenesh2_pg.C_scaffold_387000001
Sequence length 214
Sequence
MAFCNVALFILIVPVAVLASEIERGSSIQTGQSLKADEILISPGKTFGFGFVNDTGAPGK
LNVAIRVRSVETIIWTATALKGVTANAQLVLNEAQGLFVLDNGVAQVIVSCKSSNCSGVR
LDMQDDGNLVLKHSNNSVLWQSFDLPTDTLLQDQVFKGRQALISGRYSLQMTDVSAQLIF
LAAPELKNLTSYWTIPQNLPSSSTGSNNSTSQSS
Download sequence
Identical sequences D8TG75
jgi|Selmo1|432506|fgenesh2_pg.C_scaffold_387000001 XP_002994594.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]