SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|439053|estExt_fgenesh2_pg.C_50219 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|439053|estExt_fgenesh2_pg.C_50219
Domain Number 1 Region: 3-306
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.73e-31
Family G proteins 0.0005
Further Details:      
 
Domain Number 2 Region: 569-689
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000367
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|439053|estExt_fgenesh2_pg.C_50219
Sequence length 859
Sequence
MENLVSLAEAMQQASSVLLDDNDDSAQYTTFLNVVTIGNTGAGKSAVLNSIIGYTVMPTG
ENGATRAPIVVELERDQSEGKGLAVMTEGRARPSSANEIRLSLQSRISRIASSRSGRPEE
IRLRLRSSAAPPLTLIDLPGLASLDDQFVNEYGSHNDAVLLVVVPATSVRDITGSQALKM
ARELDPEFSRTVGVISKVDQSASDPKSLAAVQAVLSGQGPSASADITWVALIGQSVSIAA
AHAGSVGTDDSLETAWKAETETLRSILTAAPSTRLGRAALVDVISKQIRKRIRQRLPSLL
SGLEGRQQEVEGELVRLGEQMVETEEGTRALALELCREFEDKYILHINSGETGGWRVISS
FEGALPNKFKNLPLNDLFDLNYLKKVVLEADGYQPYLLSPEKGLRELVRRALELAKDPGK
HCVDEVHHVLVDIVAASASSTPGLGRYPPFKREVVAIASAALDEYRTHAKKMVVDLVDME
RSYIPPQHFNRLAQRRIDRLRREEETKTRVSKKAQDAEQVLLNKAAGPPVNQTPPLKSIK
GQSDKDKDSKDGKDGAPSSIAGGEISGVYLMKKSTNKSGWKKRWFVLNEKTNRKIMSMNL
QECAIDDASEKDDDDAPTTKSSKKERASDSSISLAFKITNKVPYKSVLKAHSSVVLKAES
IADKQEWIAKLRNCAQGTQQPPGKSASIVKEPSRAPEPVDTVIRRPADPDEDLRFMGQEV
RDYVEAVLNSLSANIPKIQELLQEAPDVKRRRDKCQRQSQVLNKLTHQLSMHEARVSTGS
GYTDTDGYGSPSSSKGAGEEWRVAFESASTAPPPSKSLSINGRIDRRLTATEENGDIGSS
RRSTPSRAAPAPPGSMYRG
Download sequence
Identical sequences D8R224
jgi|Selmo1|439053|estExt_fgenesh2_pg.C_50219 XP_002964815.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]