SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|439437|estExt_fgenesh2_pg.C_60502 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|439437|estExt_fgenesh2_pg.C_60502
Domain Number 1 Region: 181-291
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000275
Family alpha-D-mannose-specific plant lectins 0.0011
Further Details:      
 
Weak hits

Sequence:  jgi|Selmo1|439437|estExt_fgenesh2_pg.C_60502
Domain Number - Region: 363-408
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000486
Family Protein kinases, catalytic subunit 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|439437|estExt_fgenesh2_pg.C_60502
Sequence length 489
Sequence
MAIGMSAAASSQLCVVLLCVIPCLASLHLFAENSQLTTYQKGVIKDALGDLLATIHPDLS
YYAGSAFRRFPSEDDISITLLFHPRSQCGRTLNSTWVRSATGKDLQAGFNATLKELDELM
ERSYGTGYVLYGQFLVGYVSGEQPYGCVSLKNATVEDGVGYCYGFDSMLLSGSPFDTLYA
GCMIESPDKRFVLRMDNCQLSVMETTTNNTVWQPKVTVVQQPNCYLRLQQDWNLVLYNST
VGTSEFAKWSSATFTKIKTGAVWLEVGPDGVLTIYLGTGPGGAQSIWKSKTDSHRDFDDI
YGPPGPPVESPTNAVLQAPVPNAKPTNKFKVLSIVIMTALTFGLTSLLIVVIWQSRRLGF
YKNEPNAFASSKLQRYTFSTLLAATKNFHAANKLGEGGSAVVYKAWELYEEGQWLDLVDE
KLPPETCPKEELQRVMTVSLICTQGAPSARPAMSRVVAMLLGDIAPTLDITRPGFLPDLK
HAALSKVTS
Download sequence
Identical sequences D8R4F4
XP_002966038.1.77236 jgi|Selmo1|439437|estExt_fgenesh2_pg.C_60502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]