SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|439664|estExt_fgenesh2_pg.C_70439 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|439664|estExt_fgenesh2_pg.C_70439
Domain Number 1 Region: 392-760
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 2.22e-115
Family Oxysterol-binding protein 0.00027
Further Details:      
 
Domain Number 2 Region: 58-100,138-195
Classification Level Classification E-value
Superfamily PH domain-like 1.04e-19
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|439664|estExt_fgenesh2_pg.C_70439
Sequence length 825
Sequence
MAAASSSKPSKATGSKVPSFTARNPAAPAAFPDAGDLLAKSPTAKTRKKSHSGDVCASSA
PALAGVLHKWVNYGKGWRPRWFELEDGILFYYKIHGPDKICVQNEQIKASKIIGDESRKL
LKKPKFCSQGEERQHRRTFGEVHLKVCSLRESKSDDRKFYIYTGTKTLHLRAESKEDRTA
WMDALRTSKDLFPKDMSSLSYPPPADNIKISTGALNEHLVKLGVPEQGIKECEKIMMSEF
TKIQHQLRVMQQKRLFLIEKIRLLEADKLELETTVVDEMQNNASAGAGNVVGALKDHGIK
THSFLRLLGADESESDEDIRQEVVEAESDDEDFFDTRESLSEAYLESAVFNTTVELIENE
DVSSNGPSGEDVVYPSVKRRTRLPEPKEVENCVSLWSMIRDNIGKDLSRICLPVYFNEPL
SSLQKCFEDLEYSQLLDRAREYGQNGNRLMRILYVAAFAVSGYASTEGRHCKPFNPLLGE
TYEADFPDKGVRFIAEKVSHHPMVIACHCQGRGWELWGDSTLKSKFWGRSIQLDPVGVLT
LQFDDGETFQWSKVTSSINNIILGKLYVDHYGTMRIQGNRGLSCKLKFKEQSMIDRNPHQ
VQGYVHNEGGDKLASLIGKWDESMYYVLGDPVSNARGYDPMDTATLLWQKNPPAEFPTRY
NLTAFAITLNEITPDLKEKLPPTDSRLRPDQRYLENGEYDLANAEKQRLEQKQRQARKLQ
ETGWTPRWFKRGSDQGTYRFVKTYWEARKLGQWQGSILFFFSLLPANCIDLRDAARFVGV
ERLPEPANCAGVANSTGASEGWASSDKSFDCPTPAAPCKRFQHSM
Download sequence
Identical sequences D8R4U7
XP_002966346.1.77236 jgi|Selmo1|439664|estExt_fgenesh2_pg.C_70439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]