SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|439850|estExt_fgenesh2_pg.C_80303 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|439850|estExt_fgenesh2_pg.C_80303
Domain Number 1 Region: 725-869
Classification Level Classification E-value
Superfamily VC0467-like 7.46e-17
Family VC0467-like 0.0058
Further Details:      
 
Domain Number 2 Region: 590-702
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000088
Family PDI-like 0.011
Further Details:      
 
Weak hits

Sequence:  jgi|Selmo1|439850|estExt_fgenesh2_pg.C_80303
Domain Number - Region: 491-544
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0291
Family PDI-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|439850|estExt_fgenesh2_pg.C_80303
Sequence length 882
Sequence
MEFLAVLLGAIVLLRSIAGAAELQWKPLQSWGELQDHDLILCLATFPWNGEAKSFMREFL
ELLSRERPECAGNLELRIAHTHRDEQRTWMSLTLHKSGETFQYRGKLSAERVLAAVDHAL
VSELFQPLHTVGDLQEFIGSTDRAFVLVDLCGWTLETGRIVEDYENNEPKFGQPESVLYE
TANETSSCGSRRDELVFSSFYGNLTEAASASFLTPLSARFGVITLAQVLEDAGLEIPDGK
PWFLLRRTEDISRSWRVLDDPALLDDFLENTGVVVDEVDQDTQEIPRDRPSVFLFLSFSP
ELRGESIEALRIVREVARYYERSHQWKTSRNDSKVVPVVIEQDQPVMFRGVVVKNGQTIT
LGQKDLGAGIARILQLLLQGTGGKDDPETTAVVDKGTSQDITAESAHETSQGDFAAESQG
NGEDEGMQGQENSKVAHGKDQDVTMEISTEGTNEAMQEHEDMKSQEDVDEWRFNFGFFDS
AYALQEFLTGTSNSRPSLVAVFPDRNARYVYPDDIPLSFEGLVEFLDGTLSGAVLATLKS
TQAPVVSRKAVTPPFVNRDFHRTHPVPSVSLETFPELVMGFRKGRTNSSKSSSTSLVMFT
LPWCGFCKRMELAMHEVYKYFLIQGKDDSKSVELIVPSFYQMDCGSNDCSHILANVVENQ
EFPSLLLFPSEDKDKVSVYKGAPTVSGILHFIAKHGTSTVQPPSTITIQQNLDETSQEGE
RIGIGHVLLATEKLSANSPNFANSAVVIVSVTDDYVVGLVMNKDMPKEELLAVDQRHNVK
IGYGGPLYTRPKYIFTFTRLQNLEGFGTVSYGLSAGGPSATEKVFEIIEANKLPASEFKF
VAGHCGWTPLQLREELADGYWQLTQYREDMFQWEGELQQTNT
Download sequence
Identical sequences D8R7S8
XP_002967331.1.77236 jgi|Selmo1|439850|estExt_fgenesh2_pg.C_80303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]