SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|444041|estExt_fgenesh2_pg.C_390078 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|444041|estExt_fgenesh2_pg.C_390078
Domain Number 1 Region: 109-198
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000000366
Family alpha-D-mannose-specific plant lectins 0.0074
Further Details:      
 
Weak hits

Sequence:  jgi|Selmo1|444041|estExt_fgenesh2_pg.C_390078
Domain Number - Region: 395-452
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00863
Family Pan module (APPLE domain) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|444041|estExt_fgenesh2_pg.C_390078
Sequence length 536
Sequence
MVRFPPPAAAAAAAAAYLLFLFSTSSFVLGKRYELSPGWTAVNNESLKGAGSDGGSSYRI
LRAGEDPIVSDNGSFSLAFYDPQGTNRYFLCVLLNVGKSKPAPASLVVPIWIANSNSSFS
GKATLMLTGTHKKFILLDSTGTLKWSSGSVVGISSLELDETGNLMLISEDGSVLWQSFEH
PTNVLVPGQTLRPGMSITSVNSSSQQPGPFRGTMEASGFVFYVLPETEPTMADMLRKPQP
YQVWSVGSSSSSLESALKVCDSSKAVMAVTSSGIVISYERSSGGECGGDGKSLQVYRNDE
DTAAETQYWKLEENGDFVLRGFHEREQNWATVFALSTRANDSCKHPTACGSYGLCNSQGK
CQCVGNKELDDHTSLSCGAPSGVSASCLANEAANHHFVKIPSATYFSNAFSRPDLRSSSL
EDCSAACASNCSCAAAFFSRRGGGDCFLVDEVMGSLSLVGGGAGAEEGDYTALVKIQNAQ
LISAPLSASRGKGPSKSARTAIIFLAVLCGVLAVMLAAGGYIIKIKYPHAYNKMMT
Download sequence
Identical sequences D8S6U2
jgi|Selmo1|444041|estExt_fgenesh2_pg.C_390078 XP_002978912.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]