SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|448049|estExt_fgenesh2_pg.C_1090017 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|448049|estExt_fgenesh2_pg.C_1090017
Domain Number 1 Region: 318-600
Classification Level Classification E-value
Superfamily BEACH domain 1.57e-109
Family BEACH domain 0.0000000402
Further Details:      
 
Domain Number 2 Region: 751-1060
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.26e-43
Family WD40-repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 225-298
Classification Level Classification E-value
Superfamily PH domain-like 0.0000105
Family PreBEACH PH-like domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|448049|estExt_fgenesh2_pg.C_1090017
Sequence length 1080
Sequence
MWSDGSARAARRFSYLLLQDGEHYIQDWIATCKPPSAPRLRLHSSSWQQNWIKGRLRLCS
KSIFFEPDAASIPILMLPLNKVSRIEQLADRPELEMKGNRGFMVEVSLLVTMKKNGVDAP
YEFDKSEGTWWFILDFAPVQQFLHQAQSLLSVNSLPPPERDMILRNTAAQKEAQAHFDIS
RLEDYNEEILFNFPAAQASLQFPTSQQKTRILATGSCLHQPLHNLNNDTPVRSQKLSFII
AVAKRRHSLQHIGLEIFFKDVNMFTRQTSVGGFVDGGTAFFTFLSVQDRDNARDLLVDKL
KGQTSSIGSLLDKGSSWLDRVTAAWQAGHISNYDYLMYLNLVAGRTRCDLAQWPVMPWVL
KDYESTTLNLKDPASFRDLSKPIGALNPSRLAIFHERFQQMPCKDVSHPPFLYGTHYSAP
GYVLYWLVRVAPAHMLRLQNGRFDTPDRLFFSIGESWQSVLTNHADVKELIPEFYGLPSG
FLVTRNDVNLGVRQNGVPVGDVTLPPWAKDPDDFLIKNRRALECKHVSMNIQEWIDLIFG
YKQQGEAALAADNVFHYLTYEGAVDLDKIEDPFERMSFEAQINEFGQAPQQLFTGPHPSR
SAVETSVDFEEHRQAMVESGTGSLCAAILSRIMSKTAAFEGGATEEMRVAEAALSHTISV
GIPESVKQDSGSDTEEDDILSAKIEFKREAEASTFHQSAWSSTPKTPAWLPTPHTPQLDA
NLFRRSKSPNFMLSPRMECREQPWTLKKLTDSQQPWRVHREPVNAVLVSDDNASESSTLY
SASKDGLIKVYSLSEGFQVRATKLGNLPISSLALATSNDAYPTVLAGSYDNCVYAYSVDY
GRSLGKVRVHDDSVSCLRVSNSKMVTGSWDATVKVWTLDEGRGGWVHNSGASNTPIVVAE
IELTEHEAGIWSLDVDSTGVVVASGAEDGTVILWDIRSNGIPIWTSNDLAGSASSMRMSS
DGHKLIVVSTSGFIYAMELRRGGSILSQKNCETPLRSCEVIGDVALAGSFSGELLFWSWD
NDAATFQNLRNHSEAVTSIGVGRRHGMAASVATASEDCMIQIQQLGGRGLLHAILRSSAS
Download sequence
Identical sequences D8T4H0
jgi|Selmo1|448049|estExt_fgenesh2_pg.C_1090017 XP_002990542.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]