SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|448668|estExt_fgenesh2_pg.C_1290011 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|448668|estExt_fgenesh2_pg.C_1290011
Domain Number 1 Region: 102-173,288-315
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.76e-22
Family alpha-D-mannose-specific plant lectins 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|448668|estExt_fgenesh2_pg.C_1290011
Sequence length 371
Sequence
MYAMKLLIVSVFLVWMISILAHGTKYHLPQGWEVVNNNRLPEFTASQGNASYRLLQAGNT
SLVSQDGRFALSFFRFNDSPRYYFALVFGASNYTSSSASGVCVWSANRDNPVTENATLQL
SDQGLLQVMDSDGRVVWNSPRGVSGIEVQDSGNVVLYDSTGGVSWQSFDHPTDVLLEGQV
IVTGQSLVSSSSSSSLSSGSMKMEVVASGLIFLLELDTVQPYLVWNMWNGNLPSDVTSIN
TSCPSYRIALHYSAGSVEGRYQATRNNTSDQPCGPPTAAVLGNYSSTDLHYLKLDIDGKL
IPYIYNFGRASWESGQPFMSNIFGSCLPMTCESHSVCAGSSQCSCIVQGQDGDQEQTCPS
PSDIPLVCNHE
Download sequence
Identical sequences D8T942
XP_002992105.1.77236 jgi|Selmo1|448668|estExt_fgenesh2_pg.C_1290011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]