SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|99831|e_gw1.22.364.1 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|99831|e_gw1.22.364.1
Domain Number 1 Region: 4-142
Classification Level Classification E-value
Superfamily Cap-Gly domain 9.43e-30
Family Cap-Gly domain 0.00065
Further Details:      
 
Domain Number 2 Region: 140-377
Classification Level Classification E-value
Superfamily L domain-like 9.07e-29
Family Internalin LRR domain 0.045
Further Details:      
 
Domain Number 3 Region: 431-517
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000147
Family Ubiquitin-related 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|99831|e_gw1.22.364.1
Sequence length 557
Sequence
MAEEEEGAGFHLGQRVRSAREAQQLGTVRYVGPVEGYDGVWIGVDWDSGQSRHDGSVKGV
RYFTASGEKSGSLVRPSNLSAGWSLLEALVSRYKISMSKDDAEDMYLMSVRQRKVAVELV
GQSKVEEKQKKLNELRAASLVFAGVSSLGPPGEISSSAPNIEELDLTGNLISDWNFVTCL
CEELPRLRAVDLSYNRIDIRPEMPRPPLNLRTVVLNYCSLSWEQVDMLSKSLPFVEELHL
RHNNIRLLQTSGEAVEGFEELRVLNLEGNSLESWDEMMKLSSLRSLKTLNVSGNAITKVS
YPENIKDQWPFLQLSCLLLGKNQLADWESVDALDKFPNLTEVRLSENPIADTSKGGAPRY
VLVARLSKITVLNGSEVKPRERKDSEIRRLLFFLSFCFFFFFLVCRFEQLKKQYDISEES
VPQAGSQSSQNMAASLITITIKCVAASLGEIAPVTRKLPGSMTVGKLKLLCEALFKLKAT
KQRLFLEEKESPLPLPLDDDLESLGNIGFGQQGVILMEECKHRVAGLGIIQRTCQFKLTL
FHISFRLNAMCRVGECN
Download sequence
Identical sequences D8RRJ1
jgi|Selmo1|99831|e_gw1.22.364.1 XP_002973592.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]