SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|339496246|ref|YP_004716539.1| from Pseudomonas stutzeri ATCC 17588 = LMG 11199

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339496246|ref|YP_004716539.1|
Domain Number 1 Region: 486-661
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.32e-35
Family Histidine kinase 0.0089
Further Details:      
 
Domain Number 2 Region: 680-794
Classification Level Classification E-value
Superfamily CheY-like 2.99e-30
Family CheY-related 0.0033
Further Details:      
 
Domain Number 3 Region: 6-162
Classification Level Classification E-value
Superfamily CheY-like 2.42e-25
Family CheY-related 0.002
Further Details:      
 
Domain Number 4 Region: 131-258
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.55e-20
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.069
Further Details:      
 
Domain Number 5 Region: 290-390
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.36e-16
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.08
Further Details:      
 
Domain Number 6 Region: 415-493
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000255
Family Homodimeric domain of signal transducing histidine kinase 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|339496246|ref|YP_004716539.1|
Sequence length 801
Comment sensory box histidine kinase/response regulator [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
Sequence
MPASKNISVLFIEDSRHDAELAQLALERSGYTLQTELVYNHAGVVEALQRRRFDLILADF
ILPGFSGSQALQEARRLAPQTPFIFLSGVFSEEHAVNMMRSGAVDYVLKQNLGFLPKAVE
RALGEVNERRRRLQAEQALREVEVRARLAIDAARLGMWDYEPQSGTLIWDERCRSMLGLD
TEAPVSMGLFEQLLHPEDRERIHDEVIRAISGEDAGEFCTCYRVVFGDGSIRWMETRGQA
FFESGQCTRFVGVVMDITEQQLTTQSLRQINETLGERVEERTRERDRTWELSRDLLAVTE
LDMLPVALNPFWENALGWSYSELMQRPLTQLVHPDDLQATLEENANVGRGKVTNRFVNRM
RHRDGSYRWLSWSAVADGGRIYSAARDITSEIAAVDKLAEANRELRAQIQERERVEATLQ
QMQRLEAVGQLTAGVAHDFNNLLTVILTSASFLKNDLEQGAPLERSLRRLQYIRESGERG
ATLTGQLLAFARRQQLAPTAIDLNDTLVSLLSLLKSTLGGSVSIETDTQADIWHALVDPT
QIEMIILNLAINARDAMGDGGRLTLGTRNVVVTEPALRAEDPAPGEYVVLSVTDTGTGMS
EEVLSKAFEPFFTTKEVGKGSGLGLAQVFGFAKQSGGGARIESRVGVGTTVKVFLPRTAA
PEQPEQATALSAGSHDENSQHRILLVDDDHSVREVTAQMLENLGFAVTEAESGDHALQLL
RDGAAVDLLLADFAMPGMNGGELARAVRVRRPQLPVVFVTGYAELCELGLDGYSIIQKPF
REEQLANKIHLALREGSLADG
Download sequence
Identical sequences F8H7L4
WP_013984521.1.85630 gi|339496246|ref|YP_004716539.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]