SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|404497513|ref|YP_006721619.1| from Geobacter metallireducens GS-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404497513|ref|YP_006721619.1|
Domain Number 1 Region: 63-116
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000582
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|404497513|ref|YP_006721619.1|
Sequence length 155
Comment serine protease inhibitor, Kunitz family [Geobacter metallireducens GS-15]
Sequence
MNRKIARIGKKAGLGEGEIRSFVRIGMSGLMALIISAFTGSAQADATVPLQDHVKPQAKE
PLPEKCRLKPDGGPCKALFWKYYFDPKTNECKEFVYGGCEGVVPFETREECAQECLAQQA
EPVIPDDDCGGPFPGYPCGTKYYTVSVRDFRHLSR
Download sequence
Identical sequences Q39S91
gi|404497513|ref|YP_006721619.1| WP_011366080.1.25803 WP_011366080.1.48315 269799.Gmet_2665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]