SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|404498106|ref|YP_006722212.1| from Geobacter metallireducens GS-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404498106|ref|YP_006722212.1|
Domain Number 1 Region: 358-413
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000432
Family alpha-D-mannose-specific plant lectins 0.0037
Further Details:      
 
Weak hits

Sequence:  gi|404498106|ref|YP_006722212.1|
Domain Number - Region: 197-267
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.000288
Family Integrin alpha N-terminal domain 0.03
Further Details:      
 
Domain Number - Region: 41-131
Classification Level Classification E-value
Superfamily XCC0632-like 0.0575
Family XCC0632-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|404498106|ref|YP_006722212.1|
Sequence length 510
Comment hypothetical protein Gmet_3256 [Geobacter metallireducens GS-15]
Sequence
MKRLSLLCAVLFVALTAASTLFAAQIRVYVSEFAVTGAANKDELKSTLQTLFASRLSNDS
VLSVDSPVGADVLVKGSYIAFGKVFSLDAVAKDTSGRVIARSFQQGESQDELIPAAGKLG
QSLAAEIAAKVKPGVVMVPQPVVQPVAAPVPVPVSDVVRPSAPQPAADVVKASTTSDIVK
PQDLTRTASGGWMSQRLTGTLIGIAPGKAAADGTRDFYVADEQALRLYRKREGLKLVAEV
SFSPGDRVIAVDSADLDGDGTPEAYLTVLNGDSLASQVWVAEKDSLKRVAAKLPYYFRGI
ALNGKEYKMYAQQMSTDKDFYGDVYEVVKAGDRFELKNPIKLPRFGYLYNFNQFRDAAGN
SCTAVLNDDGYLIVYSAAGEELWRSSDKFGGSETYFKREDLANVQRTGDPFRWVFLEQRI
TVSPSGEVIVPKNEGMFVIGNNRAYKKSSIYAFTWNGSSLDEVWHTKQSQSYLADYLYDG
ARKELVALEVVKKEGLLDKGASVVVVKRVE
Download sequence
Identical sequences Q39QK5
gi|404498106|ref|YP_006722212.1| 269799.Gmet_3256 WP_004512694.1.25803 WP_004512694.1.48315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]