SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|308176913|ref|YP_003916319.1| from Arthrobacter arilaitensis Re117

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|308176913|ref|YP_003916319.1|
Domain Number 1 Region: 256-429
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000068
Family BAR domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|308176913|ref|YP_003916319.1|
Sequence length 504
Comment hypothetical protein AARI_11370 [Arthrobacter arilaitensis Re117]
Sequence
MSLRTWSIRIASTATVLAIGVASAIPAAQAGNSIQLAAGQNLESVTIEDSTGMLNEQRLR
EALEELDFNEPTDVAVYARNGEYSDDINTKTLEFAKSSHPEWISAKPEDYGDYWADGLFI
ITLSIEGRGDGQIGTYFGEDRKVSESAMESIHEAGYDDFNLSRWTDGVIAVADQAAVIMN
RPWYEHPALWIAGGSAGVVGAIVGGAVMHTRSKRRETFAEELRQGGLHLTNVTMDLDETE
LAARTLPATSQHAIELEQRFAKFMTKYRACFEAQQALESSGKKERSGYEGVRFAKEFKES
AQSLDLTDDAIIAASALYTRSASWKDAWHAQTKPLEDDLAEIRELLQDVEPELMGSAAAL
ASYREVATEQLRELSVQLEEESITVDQALDSLSALRAELTEKLDIFAQAQIEVYAESAEE
KADMQSELKKSRYESRANQNSVGTILDVLNPSSMYWRVGSYHHGYTAGVSAVTASREAAS
SSGGISSGYSGGGSFSGAGGSSRF
Download sequence
Identical sequences E1VUP5
WP_013348492.1.27002 gi|308176913|ref|YP_003916319.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]