SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AFL2T_00421 from Aspergillus flavus NRRL3357

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AFL2T_00421
Domain Number 1 Region: 26-176,224-272
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.45e-33
Family Phospholipase D 0.059
Further Details:      
 
Domain Number 2 Region: 296-455,565-658
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 5e-28
Family Nuclease 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AFL2T_00421
Sequence length 782
Comment | AFL2G_00421 | Aspergillus flavus hypothetical protein similar to phospholipase D (783 aa)
Sequence
MDKFKERIQSLEDSLKDTHIVEEAHHFKHKVGKFFNIVNPNHRHDEAHEQETDRKRTEIA
KSHRFESFAPIREGNKVKWYVDALDYLWAVSIALENAKEVIYIEDWWLSPELFLRRPAYQ
TQEWRLDQVLKRRAEAGVKIYVIVYKEAHHEKFIVIDYALAFIGGIDLCFGRWDANQHPL
ADVHPANMRDEVFPGQDFNNNRIMDFQSVAQWQANELSKADYGRMPWHDVAMGLMGDCVY
DIAEHFVLRWNFIKRDKYKRDKTVDWLMLEGRLGEDEDLVAVQRPKYPCGDYVQHPYEPL
TSKPCGAQGSARAQIVRSSADWSSGILTEHSIQNAYKEIISKAEHYVYIENQFFITATGD
QQKPVLNTIGRAIVDACVRASREGRKFRVIIVIPAIPGFAGDLRQPEATGTRAIMDYQYK
SINRGEHSIFGQLRHHGVDPEQHIFVFNLRAYDRINKTPALEALEKEAGVTYNDIQRGIA
ETIMSDSVHPSIGEEGDKGEVGYDNAQKEKEERLAKLRRYEEQAERHKPEYQPSSKDTVA
HTTMLNGGKMSDEPWEGEAEAEKANFVQEELYVHGKVCIVDDRVAICGSANINDRSQLGY
HDSELAIVVEDQDFIDSMMDGKPFKAGRVAATLRRQLWREHLGLLPAQDYDASQSPNAQP
PNVCMNQILEGPENSFVTDPMSDPLWEMWTGRATTNTEIYRMLFRADPDDDIKNFDEYDS
FRPRGNHKQGHLYDPYQPVKDVREKLDKIKGHLVWMPLRFLEDANMAEPGLQVNQITESI
YT
Download sequence
Identical sequences AFL2T_00421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]