SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MGG_00960T0 from Magnaporthe grisea 70-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MGG_00960T0
Domain Number 1 Region: 602-791,849-895
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.77e-43
Family Phospholipase D 0.081
Further Details:      
 
Domain Number 2 Region: 904-1112
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.47e-25
Family Nuclease 0.058
Further Details:      
 
Weak hits

Sequence:  MGG_00960T0
Domain Number - Region: 283-347,449-485
Classification Level Classification E-value
Superfamily PX domain 0.00313
Family PX domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MGG_00960T0
Sequence length 1646
Comment | MGG_00960 | Magnaporthe grisea (M. oryzae) 70-15 phospholipase D1 (1647 aa)
Sequence
MATSANDGGGPSTGPSIVLPPIDPHEEARIIRGHLRSHSTPSSPTIPRGTRVLGALNEEG
SDADVEETADEAAAEGEAAKVKKKRRRMRRPKMLSPSTQSGEPDSPVGTRRLKILQRRAT
MPDTRNVLSEGEGRDHLARENGWGRGSSWMGRPNDGDDPESPSGVARRGPGHVRRISMFH
GGISDGGEATPRRPFFGADRASTYGAQKWRQVKSTLKLLRKPKDNQFDFHKSAELMAELR
AGAPAVLMLASMIQRDEHGNKRIPVLLEQLRLRVTDSAPLDGEGERHWLFTIELEYGSGP
SRMCWTVKRTIREILNLHWKYKLGIDNKKYSLTLPGTRPRQPRFPTSVFPYVRGLRGVDD
EEEDNAASVRGDGDETAGYATGGEGTAAEGTDVEERGVLSRRGSRITRPNTIENRHKQST
TSLPGLFNPNPDNHYAGSTVDAAQLRRRYVEKQRKMLEKYLQETVRWLMFRADSNRLCRF
LELSALGVRLAAEGSYHGKECFLHIQSAKGIDFRRVLTPGAILDRHSRKWFLVRQSYIVC
VESPENMNIYDVYLVDSKFRINAKMNKLREIAAKRTKKDKGKEQDMDLSGDQAPEKHHRV
NIMTSERKIKLWSRNQHLIQQFEESINGMLAQTPWHRENRFGSFAPVRQGVFAQWLVDGR
DYMWNVSRAINMAKDVIYIHDWWLSPEIYMRRPPCISQKWRLDRLLQRKAEEGVKIFIII
YRNVQQAIPIDSEYTKHSLLNLHPNIFVQRSPHQFKKNQFFFAHHEKICIVDHIVAFVGG
IDLCFGRWDTPQHPVADDKLTGFEPGDYPKDTDHTQVFPGKDYSNARVLDFFRLNAPYEE
MYDRSRVPRMPWHDVAMQVVGQPARDLTRHFVQRWNYIRRGRKPTRPTPFLLPPPDCRKE
ELEDLGLTGTCEVQILRSAANWSLGITETEASIQAAYLRLIRESDHFVYMENQFFVTGGE
CMNVQFVNGVADAIVERIMKAHANDEEWRCVILIPLLPGFEGSVAEQDGSSVRLIMQCQF
RSICRGESSIFGRLRANNIEPEDYIQFFSLRQWGHIGPNKTLVTEQLYIHAKIIIVDDRI
ALIGSANINERSLLGTRDSECAAVVRDKDMIWSTMAGRPYQVGRFAHTLRLRLMREHLGL
DVDEIQEQERQLDPDHEDAEVRFSRDMENIYGSDSEAGPSVERPKPARSNHNRLPSFNHD
VDWDMLNDEDNLERSSSKQNSVNTEQSAAQKREANGHDLDHWKSAESQGLDLGRDSVIVN
GKEVLTHNVFPEGKGTMESPKGPEAAASTAGTEQFPAFEETVSNDGLPPAPSIVRRTTEQ
MGLPRPSQLPSLPVLDDTDIGGPPASYDADGKLREGLQSQWAYDIRPAHIDKDCMRDPLN
PSFYDDIWSRVAENNSKIYRRVFHCMPDSEVTNWHEYQEFLNLQGQFEQNMEAWGPDIEA
EREHQANPHKPHASGGAGIGAPAPTAVASGLAEKVTGHLPIGNDSRPEEAAPAEKPEMDL
ENEKRPLFTPNHSRQNSRLDREMAAAAERALHTPKLEIPMAFPEKSKTARDRRPTFATAE
KPGTGSSNNASHSGGGTLPRRKRGNTRASRRGFQPDQVMNKPEAEEMLGMLQGTLVQFPY
DWLVVEESNGNWLYQADLVAPLQIYN
Download sequence
Identical sequences G4ND64 L7IAT2 L7JNN5
MGG_00960T0 XP_003717990.1.18062 148305.A4RDJ2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]