SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MGG_05804T0 from Magnaporthe grisea 70-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MGG_05804T0
Domain Number 1 Region: 33-234,282-326
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.45e-39
Family Phospholipase D 0.055
Further Details:      
 
Domain Number 2 Region: 362-509,638-684
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.1e-25
Family Nuclease 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MGG_05804T0
Sequence length 857
Comment | MGG_05804 | Magnaporthe grisea (M. oryzae) 70-15 phospholipase D p1 (858 aa)
Sequence
MSGLLQKLKHEVHELKDKLEGTKLHDAKIHLTHKKHQIGKFANIFNPAHRHDEEHEKACD
EKRTKISESHRFTSFFPERDGNLIKWYVDGRDYCWAVSEALENAKETIYIADWWLSPELF
LRRPPYHNQEWRLDRVLKRKAEQGVKIYVQVYREVEAALTCNSAHTKRALLSLCPEGSPG
YGNIQVGRHPDHNVFENAADMTFYWAHHEKFIVIDYAMAFIGGLDLCFGRWDNHQHALAD
AHPEGVANEVWPGQDFNNNRIMDFKNVEDWKQNELGKVEYGRMPWHDVAMGLIGPCVFDI
AEHFVLRWNFVKRDKYKRDERYDWLELRGRQGDDEDLVGVQRPKHPVGDYVLHPLRPVEE
KNLNNRGTVHAQVVRSSDDWSSGILNEKSIQNAYIKVIEEAQHYVYIENQFFITATGDQQ
SPIHNTIGRAMVNAVLRAAKEGRKFRIIVLIPAVPGFAGDLREDAATGTRAIMDYQYKSI
CRGEHSIFEMIKKEGVDPTKYIFFFNLRSYDRLNKTPGIKQLEEESGVRYQDVQRAEAEE
IMGSAVHGTAVNGTAAARDGRDTEMGVEAEQLGQGEAQDHLTPGAEAALDAKRKFEEVQG
KQEQEVKSAYTVAHHAMAGTGPLSSELWEGEPKDEVENWIQEELYIHAKLLIADDRVVIC
GSSNLNDRSQQGNHDSELSIVMEDTHRIPSTMNGQPFEAGYHATTLRRYLWREHLGLLPP
QEHDASNDPNAQPPGENSPNDVRDGDETWKFVEDPLDEKLWETWTGQATENTDIFRHLFH
ADPDDHVKTFEDYDHFRPAKGIKTGHIFDRFIPPEDVREKLDKIKGHLVWMPLEFLSEAE
MAETGLQVNQWTESIYT
Download sequence
Identical sequences G4N0H8 L7IKW2 L7J9P2
XP_003712119.1.18062 MGG_05804T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]