SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MGG_06176T0 from Magnaporthe grisea 70-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MGG_06176T0
Domain Number 1 Region: 285-555
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 5.02e-67
Family Tyrosyl-DNA phosphodiesterase TDP1 0.0000191
Further Details:      
 
Domain Number 2 Region: 82-310
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 4.24e-66
Family Tyrosyl-DNA phosphodiesterase TDP1 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MGG_06176T0
Sequence length 555
Comment | MGG_06176 | Magnaporthe grisea (M. oryzae) 70-15 tyrosyl-DNA phosphodiesterase 1 (556 aa)
Sequence
MSGIAEDVGLGPRSLTRPISPPRKRQKADNERDARPNPVPKNDGSATKSGSGSETASEPD
IASRSKNAQQPRLESPGQAIFSSPFRLTRIRDLGEEDNADALGLNDIIGDPLIAECWDFN
YLHDIEFLLDALDQDVRDVVKVHVVHGFWKKDDPSRILLQDDAEKHKNVVLHTAFLPEIF
GTHHSKMLVLLRHDDTAQVIIHTANMIPKDWTNMTNGIWLSPRLPLLQGQDPADASQYEN
LAEGTGYKFKIDLLNYLRAYDDKRVVCRDLVTNLEKYDFSSIRGTLIASVPGRHDFTDLS
TSAWGWVAIKRALRSVPLQVGKSEVVTQISSIATLGPTDTWLQRTLFESMCRGKTTGVAP
RPQFKIIFPTADEIRRSLDGYGSGGSIHTKIQSSQQAKQLIYQKPLLCHWANDSPHGQDL
GQNIPILDAGRNRAAPHIKTYIRYGANSIDWALLSSANLSKQAWGDATGAGSQTRISSWE
IGVLVWPELFAKDALMTTVVKKDTPSRETTNLCPGRPVVGLRSPYSLPVQKYGNGEVPWV
ATLSYSEPDWAGNTW
Download sequence
Identical sequences G4N013 L7IJZ0 L7JC91
XP_003712058.1.18062 MGG_06176T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]