SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MGG_07543T0 from Magnaporthe grisea 70-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MGG_07543T0
Domain Number 1 Region: 75-236
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 5.02e-22
Family Phospholipase D 0.031
Further Details:      
 
Weak hits

Sequence:  MGG_07543T0
Domain Number - Region: 363-413,440-503
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.000785
Family Nuclease 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MGG_07543T0
Sequence length 540
Comment | MGG_07543 | Magnaporthe grisea (M. oryzae) 70-15 CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase (541 aa)
Sequence
MIVRGFSRCASRLRPTLSTPRASIRIHSRPQCRSFTGSSTAGAAPGPSTNSPTTTAGLLA
PFTTELDKIAPSFRIHGSQIRILQTPAEFYETLKDKIRHAERRIFLSTLYIGKSEKELIA
TLQEALRAKPELKVSILTDALRGSREAPEPCSASLLAPLVTEFGAERVEIRMYHTPNLTG
MRKKYIPKRINEGWGLQHMKLYGFDDEIVIANLSNDYFTNRQDRYHLFSSKEITEYFWGL
QRAVGSLSFLVQPSTESPSGFEMTWPGSNLAPSPLDEPEKFVAKSTTLIRDLISVKSAKS
NASSGDQGSQTDTSVYPLAQMSQLMRPDASTELPAVTHILSKLASPDLAGSSWTFTAGYF
NPAPSLTKLLLSAAPGGTGTVITASPYANGFFRSHGVSGMLPDAYSLLARRFLDRVERRK
GGQAVILKEWRRGTSGEPDGWTYHAKGLWVTLPGGHDIGPSLTMVGSSNYTKRSYSLDLE
ANALIVTTNDGLRKRLADEQRWLQEYAAPVRIDDFAKIERRVSLKVRISMWIVSLVGGAL
Download sequence
Identical sequences MGG_07543T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]