SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MGG_10172T0 from Magnaporthe grisea 70-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MGG_10172T0
Domain Number 1 Region: 110-337
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.28e-23
Family Phospholipase D 0.079
Further Details:      
 
Domain Number 2 Region: 431-624
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.39e-20
Family TrmB middle domain-like 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MGG_10172T0
Sequence length 680
Comment | MGG_10172 | Magnaporthe grisea (M. oryzae) 70-15 phospholipase D Active site motif protein (681 aa)
Sequence
MNLKAAETEAASADNRPEPQVDSESKKSLQQEESHRALVSTKPPPRGFGDEIFRLCTAPE
DVSSLLASNPDITPNEAWEQLYGKGSDSGPGVTNAIVNGAPPLERLERAARCGKWGENRP
SDLFLEMYHDALTTLDEDLTQGVVSPSLMGSNGVMPLTVISTIPDIVRHMANLIVAAEHD
VLIATNFWQNSEASKYITDAIRELSRRAEGRDKKVVVKVMYDRGSVRQVFDQHHIVPEKD
YTGKAVGLPKPSEIPNVDLEVMNYHNPLLGTFHAKYMVVDRRIAVLQSNNIQDNDNLEMM
VHLEGPIVDSVYDMALLSWHKALTPPLPTANKPAATETPRCFDSQYNTEDETQNGYNHNT
PDEPYPEHTTSDPHYDATISAEVRRVQASVTPIPGESRRAAVTKHLNHTTNKDFTPLAEH
LVSDSVVGEDPEKIMTPYVKHQPHQHFPMALVNRPPYGPPKNHDVKNPQNAAWLAALRCA
TRSVFIQSPTLNAEPLLPAIIDACERGVEVTCYICLGYNDIGELLPMQGGHNEMIAHRLH
TSLSEEARPRLHYHWYVAKDATAPLHQGKRQRSCHIKLLVADWKVAVVGSGNQDTQSWCH
SQEVNVLLDLPEEIAEQWREALEVRNQNTGLYGLGSNEDGVWRDAEGREADEAIGIDPGR
FSWGKGIMGAVKRLKGTGGF
Download sequence
Identical sequences A0A151V4R7 L7JKY5
XP_016846072.1.18062 MGG_10172T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]