SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MGG_05521T0 from Magnaporthe grisea 70-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MGG_05521T0
Domain Number 1 Region: 336-403,502-556
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 4.93e-22
Family Nuclease 0.022
Further Details:      
 
Domain Number 2 Region: 62-247
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 8.07e-19
Family Nuclease 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MGG_05521T0
Sequence length 568
Comment | MGG_05521 | Magnaporthe grisea (M. oryzae) 70-15 conserved hypothetical protein (569 aa)
Sequence
MARSLRRNSFVHDFIDRLQKAPKPLDTSRAYASDELPSYNYTDSLELGRLVTTSRVRSFR
VGTGASIYTSTLLPAILKAHHEAIIVTCFWAPSKTLDALRETLEALAAHRRRIVDEGAGS
LPTLRVRICLSSRSLLQKLLHTSSRDGYIYPPSTWEKQLGLLSEEKLRAARIELHVKSLF
FLPFSVMHPKFVVIDRRRAFMPSCNVSWEPWLEGCVEFEGDAVDALMAFYQRTWEPDMDV
TLPLPLMQDEDLDEAIFNPAVEAPVLPMVRSTASYAVSFVAGHQQASPLVVAGGHEATAT
LENTIQTTILPSSHHRNPRFRFLPWQAHAPAPATPLNTAVMQLMDHAQRQIYVQTPNVTA
PCVIDGLLAALQRGVHVRIVTGRNMMMMEQIVTAGTTTSRCISSLIRRYEIMREAAMAPP
GSRHSLLSSWSRPPSRNYGAGTNGEPIQTLSSLPPPVGRLQISYFCSLNPGSKETGKGKG
GRHGRRRPSDLEEVLDDAAEEPVCPHIKLMIVDGRYTLLGSGNMDRASFYTSQELGVLFH
GDAFASPVQGVMDRCLEGRLEKVYDSER
Download sequence
Identical sequences G4MM94 L7I0B0 L7JAI2
MGG_05521T0 148305.A4RPH7 XP_003710387.1.18062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]