SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MGG_06367T0 from Magnaporthe grisea 70-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MGG_06367T0
Domain Number 1 Region: 34-257
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.4e-68
Family Lectin leg-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MGG_06367T0
Sequence length 322
Comment | MGG_06367 | Magnaporthe grisea (M. oryzae) 70-15 vesicular integral-membrane protein VIP36 (323 aa)
Sequence
MWFTSCLSALCLAATGALAAISVDDSGEVKSIGLRTHSLMQPYLDSDMQSRWYDFGGDTI
IRTDQYIRLTSDRPSQMGSLWSRVPLTATNWEIEVEFKIHGKHQLYGDGFAMWVTKGRND
VGPVFGNADKFEGLGLFFDTYKNNRPGVVFPYVMAMVGDGHTAYDKDTDGKGNEFAGCSA
RGIRHASIPTKFRLTYFQDKSLKLELHYKSDGEWTTCFETDEPPTIPQVAYLGFTAETGE
LSDNHDIISISAKNLYTAQPSGSKDNKKADKTKGKKAKKVKEHKEGGSWTWMMIKIFLFI
VVIGGAYVGYTAWKTNKRSHRF
Download sequence
Identical sequences G4N7T4 L7ILR7 L7JBW2
148305.A4R8U6 XP_003717207.1.18062 MGG_06367T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]